DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54k and SrpRalpha

DIOPT Version :9

Sequence 1:NP_523931.1 Gene:Srp54k / 38593 FlyBaseID:FBgn0010747 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_524887.2 Gene:SrpRalpha / 47251 FlyBaseID:FBgn0010391 Length:614 Species:Drosophila melanogaster


Alignment Length:309 Identity:72/309 - (23%)
Similarity:134/309 - (43%) Gaps:51/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNSMLKEICAALLEADVNIRLVKQLRENVRAVID------FDEMAGGLNKRRMIQSAVFKELVKL 86
            |...|:::...|:..:|...:..:|.::|.|.:|      ||.:|.      .::.|:.:.||::
  Fly   315 LQPALEKMRDHLISKNVASEIAAKLCDSVAASLDGKQMGTFDSIAS------QVKEALTESLVRI 373

  Fly    87 VDPG-----VKPYQPIK--GKANVVMFVGLQGSGKTTTCTKLAYHYQKRNWKSCLVCADTFRAGA 144
            :.|.     ::.....|  |:...::|.|:.|.||:|...|:.:...:.::...:...|||||||
  Fly   374 LSPKRRIDIIRDALESKRNGRPYTIIFCGVNGVGKSTNLAKICFWLIENDFNVLIAACDTFRAGA 438

  Fly   145 YDQVK-----------------QNATKARIPFYGSYTEIDPVVIAQDGVDMFKREGFEMIIVDTS 192
            .:|::                 :|..:.....||.    |...||.:.:........::::|||:
  Fly   439 VEQLRTHTRHLNALHPAAKHDGRNMVQLYEKGYGK----DAAGIAMEAIKFAHDTRVDVVLVDTA 499

  Fly   193 GRHKQEESLFEEMLAVSNAVSPDNIIFVMDATIGQACEAQAKAFKDKVD----------IGSVII 247
            ||.:..|.|...:..:....:||.::||.:|.:|.....|...|...:.          |..:::
  Fly   500 GRMQDNEPLMRSLSKLIKVNNPDLVLFVGEALVGNEAVDQLVKFNQSLADYSSNENPHIIDGIVL 564

  Fly   248 TKLDG-HAKGGGALSAVAATQSPIIFIGTGEHIDDLEPFKTKPFVSKLL 295
            ||.|. ..|.|.|:|....|..||:|:|||:...||:.......|:.|:
  Fly   565 TKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYADLKAINVNAVVNSLM 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54kNP_523931.1 SRP54_euk 2..428 CDD:273615 72/309 (23%)
SRP54_N 6..83 CDD:280954 12/60 (20%)
SRP54 102..294 CDD:278855 54/219 (25%)
SRP_SPB 327..428 CDD:281039
SrpRalphaNP_524887.2 SRP-alpha_N 27..268 CDD:282006
PRK14974 258..613 CDD:237875 71/307 (23%)
SRP54_N 299..374 CDD:214941 14/64 (22%)
SRP 396..592 CDD:239389 48/199 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.