DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54k and srek1

DIOPT Version :9

Sequence 1:NP_523931.1 Gene:Srp54k / 38593 FlyBaseID:FBgn0010747 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_002934235.1 Gene:srek1 / 100329115 XenbaseID:XB-GENE-491758 Length:566 Species:Xenopus tropicalis


Alignment Length:84 Identity:13/84 - (15%)
Similarity:31/84 - (36%) Gaps:29/84 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 KKMGGVKGLFKQGDMTKNVNPTQMA--------------------------KLNQQIAKMIDPRM 470
            |::|.|:.:...||.|:   ||:.|                          |:|.....::.|..
 Frog   224 KQVGDVRFVRMAGDETQ---PTRFAFVEFSDQNSVTRALTFNGVMFGDRPLKINHSNNAIVKPPE 285

  Fly   471 LQQMGGVGGIQNMMRQLQQ 489
            :........::.:|:::::
 Frog   286 MTPQAAAKELEEVMKRVRE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54kNP_523931.1 SRP54_euk 2..428 CDD:273615
SRP54_N 6..83 CDD:280954
SRP54 102..294 CDD:278855
SRP_SPB 327..428 CDD:281039
srek1XP_002934235.1 RRM1_SREK1 8..87 CDD:240963
RRM2_SREK1 198..283 CDD:240706 11/61 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.