powered by:
Protein Alignment ATPsynCF6L and si:ch211-140m22.7
DIOPT Version :9
Sequence 1: | NP_647942.1 |
Gene: | ATPsynCF6L / 38592 |
FlyBaseID: | FBgn0035585 |
Length: | 147 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009302913.1 |
Gene: | si:ch211-140m22.7 / 570370 |
ZFINID: | ZDB-GENE-070912-73 |
Length: | 484 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 29/71 - (40%) |
Similarity: | 41/71 - (57%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 DPIYQIFLDKVREYRLKS-PKGKPVDPGPEFEAELKEVTERLALQYGGGEGVDMLEFPKFKLPDI 89
|||.::|||.:|.|..:: ..|..||.|||::..|.|...:|...|||| |:..||:||.|:.
Zfish 415 DPIQKLFLDSIRAYSSQTGAAGGLVDAGPEYQKALAEEIAKLQRLYGGG---DLSSFPEFKFPEP 476
Fly 90 DIDPIS 95
..|.:|
Zfish 477 KFDDVS 482
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170580643 |
Domainoid |
1 |
1.000 |
64 |
1.000 |
Domainoid score |
I10118 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4634 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1559269at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004897 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm6479 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12441 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.810 |
|
Return to query results.
Submit another query.