DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6L and si:ch211-140m22.7

DIOPT Version :9

Sequence 1:NP_647942.1 Gene:ATPsynCF6L / 38592 FlyBaseID:FBgn0035585 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_009302913.1 Gene:si:ch211-140m22.7 / 570370 ZFINID:ZDB-GENE-070912-73 Length:484 Species:Danio rerio


Alignment Length:71 Identity:29/71 - (40%)
Similarity:41/71 - (57%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DPIYQIFLDKVREYRLKS-PKGKPVDPGPEFEAELKEVTERLALQYGGGEGVDMLEFPKFKLPDI 89
            |||.::|||.:|.|..:: ..|..||.|||::..|.|...:|...||||   |:..||:||.|:.
Zfish   415 DPIQKLFLDSIRAYSSQTGAAGGLVDAGPEYQKALAEEIAKLQRLYGGG---DLSSFPEFKFPEP 476

  Fly    90 DIDPIS 95
            ..|.:|
Zfish   477 KFDDVS 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6LNP_647942.1 ATP-synt_F6 9..87 CDD:283226 26/61 (43%)
si:ch211-140m22.7XP_009302913.1 ATP-synt_F6 <414..474 CDD:283226 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580643
Domainoid 1 1.000 64 1.000 Domainoid score I10118
eggNOG 1 0.900 - - E1_KOG4634
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559269at2759
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - mtm6479
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12441
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.