DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6L and atp5pf

DIOPT Version :9

Sequence 1:NP_647942.1 Gene:ATPsynCF6L / 38592 FlyBaseID:FBgn0035585 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001017042.1 Gene:atp5pf / 549796 XenbaseID:XB-GENE-987263 Length:107 Species:Xenopus tropicalis


Alignment Length:85 Identity:35/85 - (41%)
Similarity:52/85 - (61%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLVLCRSVSNTA----SLRYKDPIYQIFLDKVREYRLKSPK-GKPVDPGPEFEAELKEVTERLAL 68
            |:.|.|::..||    ..:..||:.::|:||:|||..||.| |.|||.|||::.:|.|...:|..
 Frog    18 SVHLRRNIGLTAIAFNKAKELDPVQRLFVDKIREYNTKSQKSGGPVDAGPEYQKDLTEDVTKLQR 82

  Fly    69 QYGGGEGVDMLEFPKFKLPD 88
            .||||   |:.:||:||..:
 Frog    83 LYGGG---DLAKFPEFKFEE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6LNP_647942.1 ATP-synt_F6 9..87 CDD:283226 35/82 (43%)
atp5pfNP_001017042.1 ATP-synt_F6 1..98 CDD:368479 35/82 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9786
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559269at2759
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - otm48053
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4477
SonicParanoid 1 1.000 - - X4582
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.