DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6L and ATP5PF

DIOPT Version :9

Sequence 1:NP_647942.1 Gene:ATPsynCF6L / 38592 FlyBaseID:FBgn0035585 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001003701.1 Gene:ATP5PF / 522 HGNCID:847 Length:116 Species:Homo sapiens


Alignment Length:92 Identity:34/92 - (36%)
Similarity:49/92 - (53%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FSRFLKP--SLVLCRSVSNTASLRYK--DPIYQIFLDKVREYRLK-SPKGKPVDPGPEFEAELKE 61
            ||..::.  |:.|.|::..||....|  |||.::|:||:|||:.| ...|.|||...|::.||:.
Human    17 FSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELER 81

  Fly    62 VTERLALQYGGGEGVDMLEFPKFKLPD 88
            ...:|...:|   ..||..||.||..|
Human    82 ELFKLKQMFG---NADMNTFPTFKFED 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6LNP_647942.1 ATP-synt_F6 9..87 CDD:283226 31/80 (39%)
ATP5PFNP_001003701.1 ATP-synt_F6 9..104 CDD:283226 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147146
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4634
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6548
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559269at2759
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - otm40856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12441
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4477
SonicParanoid 1 1.000 - - X4582
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.