DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6L and atp-4

DIOPT Version :9

Sequence 1:NP_647942.1 Gene:ATPsynCF6L / 38592 FlyBaseID:FBgn0035585 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001379991.1 Gene:atp-4 / 179025 WormBaseID:WBGene00020275 Length:129 Species:Caenorhabditis elegans


Alignment Length:133 Identity:36/133 - (27%)
Similarity:57/133 - (42%) Gaps:31/133 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RSVSNTASLRYKDPIYQIFLDKVREYRLKSPKGKPVDPGPEFEAELKEVTERLALQYGGGEGVDM 78
            ||:|.||:.| :|.|.|.|:.|:||  :....|...:..|..:..|:|...|||           
 Worm     9 RSLSTTAACR-QDLIQQTFVTKIRE--IAKNAGNLANSDPAVKKALQEELNRLA----------- 59

  Fly    79 LEFPKFKLPDIDIDPISVDDLPEN----------QPKPEKKNRDKEVKAKEKGGEKEVKAKDGKK 133
               .||:|.:.|:    |..||.|          |...|.:.....::..:|...:.|.::|.||
 Worm    60 ---TKFQLANADV----VSKLPTNFEAAKVDSAVQSALEGQTLASLLEGVKKDHSEYVASRDAKK 117

  Fly   134 ADE 136
            |::
 Worm   118 AEQ 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6LNP_647942.1 ATP-synt_F6 9..87 CDD:283226 22/72 (31%)
atp-4NP_001379991.1 ATP-synt_F6 3..62 CDD:398910 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4634
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12441
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.