DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6L and Atp5j

DIOPT Version :9

Sequence 1:NP_647942.1 Gene:ATPsynCF6L / 38592 FlyBaseID:FBgn0035585 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001289142.1 Gene:Atp5j / 11957 MGIID:107777 Length:108 Species:Mus musculus


Alignment Length:97 Identity:37/97 - (38%)
Similarity:53/97 - (54%) Gaps:9/97 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLVLCRSVSNTASLRYK--DPIYQIFLDKVREYRLK-SPKGKPVDPGPEFEAELKEVTERLALQY 70
            |:.|.|::..||....|  ||:.::|:||:|||:.| ...|.|||.|||::.:|.....:|...|
Mouse    18 SVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGPVDIGPEYQQDLDRELYKLKQMY 82

  Fly    71 GGGEGVDMLEFPKFKLPDIDIDPISVDDLPEN 102
            |.||   |..||.||..|...:.|   |.|::
Mouse    83 GKGE---MDTFPTFKFDDPKFEVI---DKPQS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6LNP_647942.1 ATP-synt_F6 9..87 CDD:283226 33/80 (41%)
Atp5jNP_001289142.1 ATP-synt_F6 1..95 CDD:398910 32/79 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837090
Domainoid 1 1.000 68 1.000 Domainoid score I9693
eggNOG 1 0.900 - - E1_KOG4634
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6548
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - otm42928
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12441
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4477
SonicParanoid 1 1.000 - - X4582
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.