DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and UBC4

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_009638.1 Gene:UBC4 / 852376 SGDID:S000000286 Length:148 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:48/152 - (31%)
Similarity:80/152 - (52%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MDGPKRMNRELALMLEDKQNLQFRNLLVEP--NNIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDY 70
            |...||:.:||:.:..|...    :....|  :::|.|...:| |...||..|.:.:.|.||.||
Yeast     1 MSSSKRIAKELSDLERDPPT----SCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDY 61

  Fly    71 PFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMA 135
            |||||:|...|::||.|:|..|.:|:.||: :.|.|...:.:||..:.:.:.|..|::....|:|
Yeast    62 PFKPPKISFTTKIYHPNINANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIA 125

  Fly   136 GEYRNDPVRFFKMADAWVQKYS 157
            ..|:.|..::...|..|.:||:
Yeast   126 HIYKTDRPKYEATAREWTKKYA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 47/149 (32%)
UQ_con 14..153 CDD:278603 43/141 (30%)
UBC4NP_009638.1 UBCc 3..147 CDD:412187 46/148 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.