DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and UBC28

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001154446.1 Gene:UBC28 / 842728 AraportID:AT1G64230 Length:190 Species:Arabidopsis thaliana


Alignment Length:145 Identity:50/145 - (34%)
Similarity:82/145 - (56%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NRELALMLEDKQNLQFRNLLVEP--NNIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDYPFKPPRI 77
            |....|:||..|::...::|:.|  .:::.|...:| |...||..|.:.:.|.||.|||||||::
plant    45 NCSCILLLEKSQDIAMAHVLLCPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKV 109

  Fly    78 HINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDP 142
            ...|:::|.|||..|.:|:.||: |.|.|...|.:||..:.:.:.||.|::....|:|..|:.|.
plant   110 AFRTKVFHPNVNSNGSICLDILK-EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR 173

  Fly   143 VRFFKMADAWVQKYS 157
            .::...|.:|.|||:
plant   174 AKYESTARSWTQKYA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 50/145 (34%)
UQ_con 14..153 CDD:278603 46/139 (33%)
UBC28NP_001154446.1 COG5078 1..189 CDD:227410 50/145 (34%)
UBCc 1..188 CDD:294101 49/143 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.