DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and UBC12

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001319500.1 Gene:UBC12 / 820017 AraportID:AT3G08700 Length:149 Species:Arabidopsis thaliana


Alignment Length:149 Identity:51/149 - (34%)
Similarity:79/149 - (53%) Gaps:9/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KRMNRELALMLEDKQNLQFRNLLVEP---NNIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDYPFK 73
            ||::||    |.|.|.....|....|   .:|:.|...:| |...||..|.:.:.|||..|||||
plant     4 KRISRE----LRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFK 64

  Fly    74 PPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEY 138
            ||:::..|::||.|::.:|.:|:.||: |.|.|.....:||..:.:.:.||.|.:....|:|..|
plant    65 PPKVNFKTKVYHPNIDSKGSICLDILK-EQWSPAPTTSKVLLSICSLLTDPNPNDPLVPEIAHLY 128

  Fly   139 RNDPVRFFKMADAWVQKYS 157
            :.|..::...|..|.|||:
plant   129 KVDKSKYESTAQKWTQKYA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 51/149 (34%)
UQ_con 14..153 CDD:278603 46/142 (32%)
UBC12NP_001319500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.