DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and UBC29

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_565391.1 Gene:UBC29 / 816175 AraportID:AT2G16740 Length:148 Species:Arabidopsis thaliana


Alignment Length:119 Identity:42/119 - (35%)
Similarity:70/119 - (58%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEH 103
            :::.|...:| |...||..|.:.:.|.||.|||||||::...|:::|.|:|..|.:|:.||: :.
plant    29 DMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILK-DQ 92

  Fly   104 WIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMADAWVQKYS 157
            |.|...|.:||..:.:.:.||.|::....|:|..|:.|..::..||.:|.|||:
plant    93 WSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 42/119 (35%)
UQ_con 14..153 CDD:278603 38/113 (34%)
UBC29NP_565391.1 UBCc 1..146 CDD:381827 41/117 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.