DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and UBE2E1

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_003332.1 Gene:UBE2E1 / 7324 HGNCID:12477 Length:193 Species:Homo sapiens


Alignment Length:170 Identity:48/170 - (28%)
Similarity:87/170 - (51%) Gaps:28/170 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKEEPLMDGPKRMNRELALMLEDKQNLQFRNLLVEP----------NNIYKWTGLLMPVAPP- 54
            |:|..:.|....||:.:|||            ::.::|          :|||:|...::  .|| 
Human    38 MSKNSKLLSTSAKRIQKELA------------DITLDPPPNCSAGPKGDNIYEWRSTIL--GPPG 88

  Fly    55 --YDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVL 117
              |:.|.:.::|.|..:||||||::...||:||.|:|.:|.:|:.||: ::|.|...|.:||..:
Human    89 SVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSI 152

  Fly   118 LATINDPQPENAWHIEMAGEYRNDPVRFFKMADAWVQKYS 157
            .:.:.|..|.:.....:|.:|..:.....:||..|.::|:
Human   153 CSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 45/159 (28%)
UQ_con 14..153 CDD:278603 42/151 (28%)
UBE2E1NP_003332.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 2/6 (33%)
UQ_con 51..188 CDD:395127 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.