DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and ube2l3

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_031755551.1 Gene:ube2l3 / 548817 XenbaseID:XB-GENE-970758 Length:160 Species:Xenopus tropicalis


Alignment Length:159 Identity:73/159 - (45%)
Similarity:110/159 - (69%) Gaps:7/159 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PKRMNRELA----LMLED--KQNLQ-FRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLD 69
            |....:|||    :.||:  |..:: |||:.||.:|:..|.||::|..|||||||:::||:||.:
 Frog     2 PTVSQQELAHTVVMELEEIRKTGMKNFRNIQVEDSNLLTWQGLIVPDNPPYDKGAFRIEINFPAE 66

  Fly    70 YPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEM 134
            ||||||:|...|::||.|::|:||||:|::..|:|.|.|:.|||:|.|:|.:||||||:....::
 Frog    67 YPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADL 131

  Fly   135 AGEYRNDPVRFFKMADAWVQKYSEPRPTE 163
            |.||..|..:|.|.|:.:.:||.|.||.:
 Frog   132 AEEYSKDRKKFCKNAEEFTKKYGEKRPVD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 70/152 (46%)
UQ_con 14..153 CDD:278603 67/145 (46%)
ube2l3XP_031755551.1 UBCc 16..155 CDD:214562 66/138 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.