DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and ube2a

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001004868.1 Gene:ube2a / 448176 XenbaseID:XB-GENE-969236 Length:152 Species:Xenopus tropicalis


Alignment Length:136 Identity:37/136 - (27%)
Similarity:69/136 - (50%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FRNLLVEP----------NNIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMY 84
            |:.|..:|          |||..|..::. |...|::.|.:|:.|:|..:||.|||.:...::|:
 Frog    13 FKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMF 77

  Fly    85 HLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMA 149
            |.||...|.:|:.||: ..|.||..:..:|..:.:.:::|.|.:..:.:.|..|:.:...:.|..
 Frog    78 HPNVYADGSICLDILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRV 141

  Fly   150 DAWVQK 155
            .|.|::
 Frog   142 SAIVEQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 37/136 (27%)
UQ_con 14..153 CDD:278603 36/132 (27%)
ube2aNP_001004868.1 UQ_con 8..145 CDD:395127 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.