DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and vih

DIOPT Version :10

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:160 Identity:46/160 - (28%)
Similarity:79/160 - (49%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PLMDG---PKRMNRELA-LMLEDKQNLQFRNLLVEPNNIYKWTGLLM-PVAPPYDKGAYKMEIDF 66
            |:.|.   .||:::||. ||:.:::.:   :...:..||:||.|.:. |....|....|::.:||
  Fly    26 PVKDNHAVSKRLHKELMNLMMANERGI---SAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDF 87

  Fly    67 PLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVL---QVLLATINDPQPEN 128
            |..||:..|.:...|..:|.||:.:|.:|:.||: :.|.....:..:|   |.||...|:..|.|
  Fly    88 PNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILK-DKWSALYDVRTILLSIQSLLGEPNNESPLN 151

  Fly   129 AWHIEMAGEYRNDPVRFFKMADAWVQKYSE 158
            |    .|....||...:.|..||:.:|:.:
  Fly   152 A----QAAMMWNDQKEYKKYLDAFYEKHKD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 UBCc_UBE2L3 11..158 CDD:467421 44/154 (29%)
vihNP_648582.1 UBCc_UBE2C 34..173 CDD:467411 43/146 (29%)

Return to query results.
Submit another query.