DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and CG5823

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:92 Identity:30/92 - (32%)
Similarity:46/92 - (50%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PNNIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEV 101
            ||||.:|...:. |...||..|.|...:.||.::|||||.|::.|.......|.|  :|:.|.:.
  Fly    40 PNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSIYMLTPNGRFKTNTR--LCLSISDF 102

  Fly   102 --EHWIPTTRIDQVLQVLLATINDPQP 126
              :.|.||..:..:|..||:.:.:..|
  Fly   103 HPDTWNPTWCVGTILTGLLSFMLESTP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 30/92 (33%)
UQ_con 14..153 CDD:278603 30/92 (33%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.