DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and Ubc4

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:152 Identity:43/152 - (28%)
Similarity:76/152 - (50%) Gaps:14/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RMNRELALMLEDKQNLQFRNLLVEPNNIYKWTGLLMPVA----PPYDKGAYKMEIDFPLDYPFKP 74
            |:.||...::..::.:|. ::.:|..| ..||.|...:|    .||:.|.:.:||..|..|||.|
  Fly     8 RIKREFKEVMRSEEIVQC-SIKIELVN-DSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNP 70

  Fly    75 PRIHINTRMYHLNVNE-RGQVCVPILEVEHWIPTTRIDQV---LQVLLATINDPQPENAWHIEMA 135
            |::...||::|.|::. .|.:|:.||: ::|.....:..|   ||.|||......|::|   .:|
  Fly    71 PKVRFITRIWHPNISSVTGAICLDILK-DNWAAAMTLRTVLLSLQALLAAAEPDDPQDA---VVA 131

  Fly   136 GEYRNDPVRFFKMADAWVQKYS 157
            .::::....|...|..|...|:
  Fly   132 YQFKDKYDLFLLTAKHWTNAYA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 43/152 (28%)
UQ_con 14..153 CDD:278603 41/146 (28%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 42/150 (28%)
UQ_con 8..149 CDD:278603 41/146 (28%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.