DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and CG7220

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster


Alignment Length:154 Identity:35/154 - (22%)
Similarity:69/154 - (44%) Gaps:31/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KRMNRELALMLE--------DKQNLQFRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLD 69
            :|:::||..:::        |.:::| :||.....||..:.|.|      |:...:::...|...
  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQ-QNLSEWKINIKGFEGTL------YEGEDFQLLFKFNNK 102

  Fly    70 YPFKPPRI-HINTRM-YHLNVNERGQVCVPILEVEHWIPTTRIDQV---LQVLLATINDPQ--PE 127
            |||..|.: .|.|.: .|.:|...|.:|:.|| .|.|.|...:..|   :..:|::..:.:  |:
  Fly   103 YPFDSPEVTFIGTNIPVHPHVYSNGHICLSIL-TEDWSPALSVQSVCLSIASMLSSCREKKRPPD 166

  Fly   128 NAWHIEMAGE--------YRNDPV 143
            |..:::...:        |.:|.|
  Fly   167 NTIYVKTCNKNPKKTKWWYHDDSV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 35/154 (23%)
UQ_con 14..153 CDD:278603 35/153 (23%)
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.