DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and Ubc2

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:150 Identity:45/150 - (30%)
Similarity:81/150 - (54%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KRMNRELALMLEDKQNLQFRNLLVEP--NNIYKWTGLLMPVAPP---YDKGAYKMEIDFPLDYPF 72
            ||:.:|||.:..|..    .|....|  :|:|:|...::  .||   |:.|.:.::|.|..:|||
  Fly    89 KRIQKELAEITLDPP----PNCSAGPKGDNLYEWVSTIL--GPPGSVYEGGVFFLDIHFSPEYPF 147

  Fly    73 KPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGE 137
            |||::...||:||.|:|.:|.:|:.||: ::|.|...|.:||..:.:.:.|..|.:.....:|.:
  Fly   148 KPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ 211

  Fly   138 YRNDPVRFFKMADAWVQKYS 157
            |..:.....::|..|.::|:
  Fly   212 YLQNREEHDRIARLWTKRYA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 45/149 (30%)
UQ_con 14..153 CDD:278603 42/143 (29%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 44/148 (30%)
UQ_con 90..227 CDD:278603 42/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.