DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and CG40045

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster


Alignment Length:139 Identity:39/139 - (28%)
Similarity:72/139 - (51%) Gaps:17/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LVEPNNIYKWTGLLMPVAPP---YDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCV 96
            |::.|:|::|..|:  :.||   |:.|.:|..:.||.:||.:|||:...|.::|.|:.:.|.||:
  Fly    29 LIDENDIFRWEVLI--IGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFVTEIWHPNIEKNGDVCI 91

  Fly    97 PILE------------VEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMA 149
            .||.            .|.|:|...::.:|..:::.:.||..|:..:::.|.|:|.....|.:..
  Fly    92 SILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANVDAAKEWRESYTDFKRKV 156

  Fly   150 DAWVQKYSE 158
            ...|:|..|
  Fly   157 ARCVRKSQE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 38/137 (28%)
UQ_con 14..153 CDD:278603 36/132 (27%)
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.