DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and CG5440

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:147 Identity:43/147 - (29%)
Similarity:81/147 - (55%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KRMNRELALMLEDKQNLQFRNLLVEPNNIYKWTGLLM-PVAPPYDKGAYKMEIDFPLDYPFKPPR 76
            ||:.:||..:..|..  |:.:...:.:|:|:||..:: |....|:.|.:|::|.||::|||.||.
  Fly    24 KRIQKELDEITRDPP--QYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPV 86

  Fly    77 IHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRND 141
            :...|.:||.|::..|.:|:.||: |.|.|...|.::|..:.:.:.|..|::....::..||..:
  Fly    87 VIFRTPIYHCNIHRLGFICLDILK-EKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYLKN 150

  Fly   142 PVRFFKMADAWVQKYSE 158
            .....|.|..|.::|::
  Fly   151 RAEHDKKARLWTKRYAK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 43/145 (30%)
UQ_con 14..153 CDD:278603 40/139 (29%)
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 43/147 (29%)
UQ_con 25..162 CDD:278603 40/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.