DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and CG2574

DIOPT Version :10

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:132 Identity:39/132 - (29%)
Similarity:73/132 - (55%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NIYKWT-GLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEH 103
            ::..|| |:..||...|:.|.::::|.||..|||:.|||...||:||.||:.||.:|:.:|. |.
  Fly    90 DLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAICLDVLG-ER 153

  Fly   104 WIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMADAWVQKYSEPRPTEEELAK 168
            |.|...:.:||..:...:::..|::...:.:|.:|:.:.....|:|..|.:.::..:..::...|
  Fly   154 WSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHWTKLFAMTKAQDKNREK 218

  Fly   169 FA 170
            .|
  Fly   219 DA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 UBCc_UBE2L3 11..158 CDD:467421 37/118 (31%)
CG2574NP_572796.1 UBCc_UEV 66..204 CDD:483950 37/114 (32%)

Return to query results.
Submit another query.