DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and UbcE2H

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster


Alignment Length:169 Identity:42/169 - (24%)
Similarity:84/169 - (49%) Gaps:14/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GPKRMNRELALMLEDKQNLQFRNLLVEPNNIY-KWTGLLMPVAPPYDKGAYKMEIDFPLDYPFKP 74
            |.:||:.::..::|.|..:   .:|...|..: |:.|   |...||:.|.:|:.:..|.:||||.
  Fly     7 GKRRMDNDVIKLIESKHEV---TILGGLNEFHVKFFG---PTETPYEGGVWKVRVYLPDNYPFKS 65

  Fly    75 PRIHINTRMYHLNVNE-RGQVCVPILEVEHWIPTTRIDQVLQVLL-ATINDPQPENAWHIEMAGE 137
            |.|....::||.|::| .|.||:.::. :.|.....:..:.:..| ..:..|.|.:..:.:.|..
  Fly    66 PSIGFVNKIYHPNIDESSGTVCLDVIN-QAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAAL 129

  Fly   138 YRNDPVRFFKMADAWVQKYSEPRPTEEELAKFARKRKKA 176
            |.::|..:.:....:||:|:    ||:.|....::|:.:
  Fly   130 YLHEPEEYHRKVADYVQRYA----TEDALRAAQQERESS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 37/148 (25%)
UQ_con 14..153 CDD:278603 34/141 (24%)
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 37/148 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.