DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and Ube2l6

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001019926.1 Gene:Ube2l6 / 295704 RGDID:1307960 Length:153 Species:Rattus norvegicus


Alignment Length:154 Identity:54/154 - (35%)
Similarity:83/154 - (53%) Gaps:1/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MDGPKRMNRELALMLEDKQNLQFRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLDYPFK 73
            |...||:.:||. .|..:.....|:|..:..|:..|..||:|...||...|:.:.||||.:||.|
  Rat     1 MTASKRVAKELD-DLSKELPPYLRHLSSDDANVLVWHMLLLPDQLPYRLKAFGLRIDFPREYPLK 64

  Fly    74 PPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEY 138
            ||.:...|::||.|::|.|.||:|::..|:|.|.|:..|||:.|...::.|..|....:|:|...
  Rat    65 PPTLRFTTKIYHPNISEDGLVCLPLISTENWKPYTKAYQVLEALNILVSRPNLEEPVRLELADLL 129

  Fly   139 RNDPVRFFKMADAWVQKYSEPRPT 162
            ..||..|.|.|:.:..:|...||:
  Rat   130 TQDPEMFRKKAEEFTLQYGVDRPS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 51/145 (35%)
UQ_con 14..153 CDD:278603 49/138 (36%)
Ube2l6NP_001019926.1 COG5078 1..147 CDD:227410 51/146 (35%)
UQ_con 6..144 CDD:278603 49/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336859
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4246
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.