DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and ubc14

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_594859.1 Gene:ubc14 / 2541565 PomBaseID:SPAC1250.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:121 Identity:41/121 - (33%)
Similarity:71/121 - (58%) Gaps:1/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NNIYKWT-GLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVE 102
            :|::.|. ..|.|....|..|.:...:.|||||||:||.|...||:||.|.:..|.||:.||:.:
pombe    34 DNLFHWACTALGPSDSVYAGGKFHFSLKFPLDYPFQPPTIEFTTRIYHPNFDSEGNVCLAILKQQ 98

  Fly   103 HWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMADAWVQKYSE 158
            .:.|:.::..||:.:|..:.:|.|::.....:|.:||||...|.|:|..:|:::::
pombe    99 VFKPSIKLRSVLEQILQLLREPNPDDPLVASIAEQYRNDRPSFDKIARDYVEQFAK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 41/119 (34%)
UQ_con 14..153 CDD:278603 40/114 (35%)
ubc14NP_594859.1 COG5078 12..154 CDD:227410 41/119 (34%)
UQ_con 12..149 CDD:278603 40/114 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.