DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and Ube2l3

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_033482.1 Gene:Ube2l3 / 22195 MGIID:109240 Length:154 Species:Mus musculus


Alignment Length:151 Identity:69/151 - (45%)
Similarity:104/151 - (68%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NRELALMLEDKQNL---QFRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRI 77
            :|.|...||:.:..   .|||:.|:..|:..|.||::|..|||||||:::||:||.:||||||:|
Mouse     4 SRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKI 68

  Fly    78 HINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDP 142
            ...|::||.|::|:||||:|::..|:|.|.|:.|||:|.|:|.:||||||:....::|.||..|.
Mouse    69 TFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDR 133

  Fly   143 VRFFKMADAWVQKYSEPRPTE 163
            .:|.|.|:.:.:||.|.||.:
Mouse   134 KKFCKNAEEFTKKYGEKRPVD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 66/144 (46%)
UQ_con 14..153 CDD:278603 64/139 (46%)
Ube2l3NP_033482.1 UBCc 6..149 CDD:214562 65/142 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.