DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and ubc-24

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_495769.2 Gene:ubc-24 / 186057 WormBaseID:WBGene00006719 Length:160 Species:Caenorhabditis elegans


Alignment Length:151 Identity:40/151 - (26%)
Similarity:80/151 - (52%) Gaps:14/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RMNRELALMLEDKQNL--QFRNLLVEPNNIYKW----TGLLMPVAPPYDKGAYKMEIDFPLDYPF 72
            |:.:|:|.:.::|:..  .||. :.:..:|:::    .|:|      |....:.:.:|..::|||
 Worm    17 RIRKEIADLAKNKRRFIKDFRK-IEKCKDIFQFKIIGDGVL------YKNMIFTLTLDVNVEYPF 74

  Fly    73 KPPRIHINTRMYHLNVNE-RGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAG 136
            |||.:.....:||.||:. ..::|.|:|..|:|.|.|.::.||..|:..:|:|......:|:.|.
 Worm    75 KPPYLKFCHNVYHPNVDPVTCELCSPMLLQENWKPETTMEDVLLNLIVLLNEPDLSRPVNIDAAH 139

  Fly   137 EYRNDPVRFFKMADAWVQKYS 157
            :|.::.|.|.|.:....:|::
 Worm   140 DYIHNKVEFVKKSTELAKKWN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 40/151 (26%)
UQ_con 14..153 CDD:278603 39/145 (27%)
ubc-24NP_495769.2 UBCc 17..160 CDD:214562 40/149 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S537
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.