DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17030 and ubc-18

DIOPT Version :9

Sequence 1:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_498541.1 Gene:ubc-18 / 175985 WormBaseID:WBGene00006713 Length:153 Species:Caenorhabditis elegans


Alignment Length:156 Identity:63/156 - (40%)
Similarity:100/156 - (64%) Gaps:7/156 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MDGPKRMNRELALMLEDKQNL---QFRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLDY 70
            |...:|:.:||.    |.:|.   .:.|:..|..|:.|||.||:|...||:|||:|:.|.||:||
 Worm     1 MSATRRLQKELG----DLKNCGVKAYENVECEETNLLKWTVLLIPDKEPYNKGAFKVGITFPVDY 61

  Fly    71 PFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMA 135
            |||||::...|::||.||:|.|:.|:||:..|:|.|.|:.:||:..||:.||:|:|.:....::|
 Worm    62 PFKPPKVAFETKIYHPNVDEEGKFCLPIVTAENWKPATKTEQVMMALLSLINEPEPSHPIRADVA 126

  Fly   136 GEYRNDPVRFFKMADAWVQKYSEPRP 161
            .|::.|..:|.|.|:...:|::|.||
 Worm   127 EEFQKDHKKFMKTAEEHTRKHAEKRP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17030NP_647941.1 COG5078 12..158 CDD:227410 59/148 (40%)
UQ_con 14..153 CDD:278603 58/141 (41%)
ubc-18NP_498541.1 UBCc 4..144 CDD:238117 58/143 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S537
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.