DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and LRIG2

DIOPT Version :10

Sequence 1:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_055628.1 Gene:LRIG2 / 9860 HGNCID:20889 Length:1065 Species:Homo sapiens


Alignment Length:507 Identity:111/507 - (21%)
Similarity:194/507 - (38%) Gaps:159/507 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CTRRRDMKLMCYCTPDENHVPVQKAECWVFSEGL-----------HQNDTTWTRFYQQKRLRELK 162
            |:||:              :|   |..|....||           |...:.|....:.:.|:|:|
Human    56 CSRRK--------------LP---APSWRALSGLLPPDTAILDFSHNRLSNWNISLESQTLQEVK 103

  Fly   163 FVIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAF 227
               .|...|..|| ...||..|::.:.:.::.:..:.:.|....|.||.:.|::|.|..:...:|
Human   104 ---MNYNELTEIP-YFGEPTSNITLLSLVHNIIPEINAQALQFYPALESLDLSSNIISEIKTSSF 164

  Fly   228 ANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLF-LNNNNISTLHEGLFADMARLTFLNLAHNQI 291
            . .::|:.|||.:|:|..::...|.||.....:. ||.|.:|.:...:| .:..|.||.|..|:|
Human   165 P-RMQLKYLNLSNNRITTLEAGCFDNLSSSLLVVKLNRNRMSMIPPKIF-KLPHLQFLELKRNRI 227

  Fly   292 NVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVF--------------------------------- 323
            .::....|:||.:|..||:.||.::.:.|..|                                 
Human   228 KIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQL 292

  Fly   324 -----------AELWS----LSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLR- 372
                       .:.|.    ||||:|..|::.|:.|.|..||:.|:.|||.:|.:..|.:|:.| 
Human   293 YVSQNAIERISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRF 357

  Fly   373 --------------------------GTPALLSINVQANKLETLTFYTF---------------- 395
                                      |..:|..:.:|.|:::::|...|                
Human   358 LSNLQTLDLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKSITKKAFIGLESLEHLDLNNNAI 422

  Fly   396 QPIMDNLVNST--SELLVSDNKFICDCRLQWIFE--LKNRTRHLQ---------------LRDSL 441
            ..|.:|..:.|  .||:::.:..:|||.|:|:.:  :.|..:|..               |...|
Human   423 MSIQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLVDNNFQHSVNVSCAHPEWLAGQSILNVDL 487

  Fly   442 EDLHCTLQEPKLSHFVDPV----PPTILDV--LNIG-GFTAIGSNSASMGGV 486
            :|..|       ..|:.|.    |.||:.:  :|:. ..||:.|:.:.|..|
Human   488 KDFVC-------DDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTV 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_523930.3 LRR <157..459 CDD:443914 91/412 (22%)
leucine-rich repeat 185..208 CDD:275380 1/22 (5%)
leucine-rich repeat 209..232 CDD:275380 6/22 (27%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 5/23 (22%)
leucine-rich repeat 281..304 CDD:275380 9/22 (41%)
leucine-rich repeat 305..328 CDD:275380 7/66 (11%)
leucine-rich repeat 329..352 CDD:275380 11/22 (50%)
leucine-rich repeat 353..376 CDD:275380 9/49 (18%)
LRIG2NP_055628.1 RNA1 <54..184 CDD:444072 34/149 (23%)
LRR 1 76..97 2/20 (10%)
LRR 2 98..119 8/24 (33%)
leucine-rich repeat 99..121 CDD:275378 9/25 (36%)
LRR 121..552 CDD:443914 92/421 (22%)
LRR 3 121..142 2/20 (10%)
leucine-rich repeat 122..145 CDD:275378 1/22 (5%)
LRR 4 145..166 6/21 (29%)
leucine-rich repeat 146..168 CDD:275380 6/22 (27%)
LRR 5 168..189 7/20 (35%)
leucine-rich repeat 169..192 CDD:275380 9/22 (41%)
LRR 6 193..214 5/21 (24%)
leucine-rich repeat 194..216 CDD:275380 5/22 (23%)
LRR 7 216..237 7/20 (35%)
leucine-rich repeat 217..240 CDD:275380 9/22 (41%)
LRR 8 240..261 7/20 (35%)
leucine-rich repeat 241..264 CDD:275380 7/22 (32%)
LRR 9 264..285 0/20 (0%)
leucine-rich repeat 265..288 CDD:275380 0/22 (0%)
LRR 10 288..309 1/20 (5%)
leucine-rich repeat 289..312 CDD:275380 1/22 (5%)
LRR 11 312..333 9/20 (45%)
leucine-rich repeat 313..336 CDD:275380 11/22 (50%)
LRR 12 336..357 7/20 (35%)
leucine-rich repeat 337..360 CDD:275380 8/22 (36%)
LRR 13 360..382 0/21 (0%)
leucine-rich repeat 361..385 CDD:275380 0/23 (0%)
LRR 14 387..408 5/20 (25%)
leucine-rich repeat 388..411 CDD:275380 5/22 (23%)
LRR 15 411..432 2/20 (10%)
leucine-rich repeat 412..434 CDD:275380 2/21 (10%)
Ig 509..598 CDD:472250 6/24 (25%)
Ig strand B 515..519 CDD:409353 0/3 (0%)
Ig strand C 530..534 CDD:409353 1/3 (33%)
Ig strand E 563..567 CDD:409353
Ig strand F 577..582 CDD:409353
Ig strand G 589..594 CDD:409353
IgI_LRIG1-like 603..693 CDD:409420
Ig strand A 603..606 CDD:409420
Ig strand A' 610..614 CDD:409420
Ig strand B 617..626 CDD:409420
Ig strand C 632..637 CDD:409420
Ig strand C' 640..642 CDD:409420
Ig strand D 650..654 CDD:409420
Ig strand E 658..665 CDD:409420
Ig strand F 671..679 CDD:409420
Ig strand G 682..693 CDD:409420
I-set 696..783 CDD:400151
Ig strand B 713..717 CDD:409353
Ig strand C 726..730 CDD:409353
Ig strand E 749..753 CDD:409353
Ig strand F 763..768 CDD:409353
Ig strand G 776..779 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 963..990
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1003..1040
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.