DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and lgi1

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001072366.1 Gene:lgi1 / 779819 XenbaseID:XB-GENE-954918 Length:547 Species:Xenopus tropicalis


Alignment Length:191 Identity:45/191 - (23%)
Similarity:82/191 - (42%) Gaps:44/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 LCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGD 320
            |||       |..::......|:..|:|:   .::...:....|..:.:|.:|..|.|..:.|.|
 Frog    49 LCE-------NAKSIPRTFLPDVISLSFV---RSEFTEIPEGSFLHIPSLQLLLFTSNAFDAISD 103

  Fly   321 TVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQAN 385
            ..|..|..|..|.:::|:|:.||..|..||.:|..|:|.||.|:.:...:.:|..:|.:::::. 
 Frog   104 DAFTGLPHLEYLFIENNKIKSISRNAFRGLKSLIHLSLANNNLQSLPKDVFKGLDSLTNVDLRG- 167

  Fly   386 KLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQWIFELKNRTRHLQLRDSLEDLHC 446
                                        |.|.|||:|:|:.|..::|     ..::|.:||
 Frog   168 ----------------------------NAFHCDCKLKWLVEWLDKT-----NATVEQIHC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 7/34 (21%)
LRR_8 183..243 CDD:290566
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380
LRR_RI <225..416 CDD:238064 34/159 (21%)
LRR_8 232..291 CDD:290566 7/34 (21%)
leucine-rich repeat 233..256 CDD:275380 45/191 (24%)
leucine-rich repeat 257..280 CDD:275380 4/22 (18%)
leucine-rich repeat 281..304 CDD:275380 3/22 (14%)
LRR_8 304..363 CDD:290566 22/58 (38%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
leucine-rich repeat 329..352 CDD:275380 9/22 (41%)
LRR_8 352..416 CDD:290566 9/63 (14%)
leucine-rich repeat 353..376 CDD:275380 7/22 (32%)
LRRCT 414..>450 CDD:214507 12/33 (36%)
lgi1NP_001072366.1 leucine-rich repeat 66..87 CDD:275378 3/23 (13%)
LRR_8 87..146 CDD:338972 22/58 (38%)
leucine-rich repeat 88..111 CDD:275378 8/22 (36%)
leucine-rich repeat 112..135 CDD:275378 9/22 (41%)
leucine-rich repeat 136..159 CDD:275378 7/22 (32%)
PCC 141..>216 CDD:188093 18/89 (20%)
leucine-rich repeat 160..172 CDD:275378 3/40 (8%)
EPTP 221..260 CDD:367630
EPTP 267..305 CDD:367630
EPTP 313..357 CDD:367630
EPTP 362..402 CDD:367630
EPTP 409..449 CDD:367630
EPTP 455..494 CDD:367630
EPTP 501..540 CDD:367630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.