| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_084072.1 | Gene: | Lrg1 / 76905 | MGIID: | 1924155 | Length: | 342 | Species: | Mus musculus |
| Alignment Length: | 312 | Identity: | 81/312 - (25%) |
|---|---|---|---|
| Similarity: | 131/312 - (41%) | Gaps: | 69/312 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 190 IEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNL 254
Fly 255 PLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIG 319
Fly 320 DTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQA 384
Fly 385 NKLETLTFYTFQ--------PIMDNLVNSTSELL----------------VSDNKFICD------ 419
Fly 420 CRLQWIFELKNRTRHLQLRDSLEDLHCTLQEPKLSHFVDPVPPTILDVLNIG 471 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 28/100 (28%) |
| LRR_8 | 183..243 | CDD:290566 | 16/52 (31%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 3/17 (18%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 6/22 (27%) | ||
| LRR_RI | <225..416 | CDD:238064 | 56/214 (26%) | ||
| LRR_8 | 232..291 | CDD:290566 | 18/58 (31%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 304..363 | CDD:290566 | 19/58 (33%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 352..416 | CDD:290566 | 19/87 (22%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 7/22 (32%) | ||
| LRRCT | 414..>450 | CDD:214507 | 12/41 (29%) | ||
| Lrg1 | NP_084072.1 | leucine-rich repeat | 65..86 | CDD:275380 | 3/17 (18%) |
| LRR_8 | 66..121 | CDD:290566 | 16/60 (27%) | ||
| LRR_RI | <74..294 | CDD:238064 | 63/243 (26%) | ||
| leucine-rich repeat | 87..110 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 109..169 | CDD:290566 | 25/83 (30%) | ||
| leucine-rich repeat | 111..134 | CDD:275380 | 12/46 (26%) | ||
| leucine-rich repeat | 135..158 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 159..182 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 162..217 | CDD:290566 | 18/54 (33%) | ||
| leucine-rich repeat | 183..206 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 205..265 | CDD:290566 | 14/59 (24%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 231..254 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | 4/22 (18%) | ||
| LRRCT | 292..338 | CDD:214507 | 16/60 (27%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167831252 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||