DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Con and lgi3

DIOPT Version :9

Sequence 1:	NP_001246635.1	Gene:	Con / 38590	FlyBaseID:	FBgn0005775	Length:	691	Species:	Drosophila melanogaster
Sequence 2:	NP_001034768.1	Gene:	lgi3 / 654830	ZFINID:	ZDB-GENE-060217-4	Length:	551	Species:	Danio rerio

Alignment Length:	187	Identity:	40/187 - (21%)
Similarity:	69/187 - (36%)	Gaps:	58/187 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   260 LFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFA 324
            |.:.|...:.:.||.|:.|..|.||.|..|..:|::.:.|.|||:|..|.:..|::..:....|.
Zfish    71 LTMVNAAFTEIPEGAFSHMHLLQFLLLNSNTFSVISDDAFSGLGHLQYLFIENNDIQALSKHTFR 135

  Fly   325 ELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLET 389
            .|.||:.|.|.:|.::.:.......|:.|..|:||.
Zfish   136 GLKSLTHLSLSNNNLQVLPRELFKHLDILTDLDLRG----------------------------- 171

  Fly   390 LTFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQWIFELKNRTRHLQLRDSLEDLHC 446
                                    |.|.|||:::|:.:...:|     ..|:..::|
Zfish   172 ------------------------NSFRCDCKIKWLVDWMEKT-----NTSVPPIYC 199

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Con	NP_001246635.1	LRR_RI	<147..291	CDD:238064	11/30 (37%)
		LRR_8	183..243	CDD:290566
		leucine-rich repeat	185..208	CDD:275380
		leucine-rich repeat	209..232	CDD:275380
		LRR_RI	<225..416	CDD:238064	32/155 (21%)
		LRR_8	232..291	CDD:290566	11/30 (37%)
		leucine-rich repeat	233..256	CDD:275380
		leucine-rich repeat	257..280	CDD:275380	6/19 (32%)
		leucine-rich repeat	281..304	CDD:275380	9/22 (41%)
		LRR_8	304..363	CDD:290566	15/58 (26%)
		leucine-rich repeat	305..328	CDD:275380	5/22 (23%)
		leucine-rich repeat	329..352	CDD:275380	5/22 (23%)
		LRR_8	352..416	CDD:290566	5/63 (8%)
		leucine-rich repeat	353..376	CDD:275380	4/22 (18%)
		LRRCT	414..>450	CDD:214507	9/33 (27%)
lgi3	NP_001034768.1	LRR_8	92..150	CDD:290566	20/57 (35%)
		leucine-rich repeat	92..115	CDD:275378	9/22 (41%)
		LRR_4	115..>150	CDD:289563	10/34 (29%)
		leucine-rich repeat	116..139	CDD:275378	5/22 (23%)
		LRR	137..160	CDD:197688	6/22 (27%)
		leucine-rich repeat	140..163	CDD:275378	5/22 (23%)
		leucine-rich repeat	164..176	CDD:275378	6/64 (9%)
		LRRCT	172..220	CDD:214507	9/33 (27%)
		EPTP	224..265	CDD:281697
		EPTP	271..311	CDD:281697
		EPTP	316..362	CDD:281697
		EPTP	365..407	CDD:281697
		EPTP	412..454	CDD:281697
		EPTP	457..498	CDD:281697
		EPTP	503..543	CDD:281697
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574230
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X486
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.930