DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and lgi2b

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001034731.1 Gene:lgi2b / 654828 ZFINID:ZDB-GENE-060217-3 Length:545 Species:Danio rerio


Alignment Length:327 Identity:74/327 - (22%)
Similarity:136/327 - (41%) Gaps:48/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 IPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNL 238
            :|..|...:.:||.:...:.:   :....|:.:|.|:.::|::|....:.:|||:....|..|.:
Zfish    55 LPRTIPSDINSLSIVNCSFPE---INEAMFSLMPSLQLLLLSSNSFSEIKEDAFSGLPHLEYLFI 116

  Fly   239 EHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLG 303
            |.|:|.|:::||||.|.....|.|.|||:.:|...||:::..|..|:|..|..:.....::.   
Zfish   117 EGNKIEEINKYAFRGLRDVTHLSLANNNLKSLPRALFSELRSLIELDLRGNMFHCDCESMWL--- 178

  Fly   304 NLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNT-------LKTLNLRNN 361
               :|.|.|:|.. |.|...|...::..:.|.|     :.|:....::|       |.|.::..:
Zfish   179 ---MLWLKRSNAT-ISDVYCASPSAMKGVLLKD-----VPEKHSKCVSTDFVQHQILNTQSMSAD 234

  Fly   362 LL-KKIDNGLLRGTPALLS-INVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQW 424
            :. .|.|..:....|...| |.::.:.:|| .|..|..|..........:|:::..|:.      
Zfish   235 IFTHKDDIYVAMAVPNSDSCIIMEWDHIET-KFRPFDDITGRSAVGCRSVLINEQAFVI------ 292

  Fly   425 IFELKNRTRHLQLRDSLEDLHCTLQEPKLSHF-----VDPVPPTILDVLNIGG---FTAIGSNSA 481
                     .|||.|..........:.|.:.|     ::...|..::|..||.   |..:.|:.|
Zfish   293 ---------VLQLFDGSLVYKYDQAQNKFTKFQAVEMLNVSKPNDIEVFQIGDDWFFLIVDSSKA 348

  Fly   482 SM 483
            .|
Zfish   349 GM 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 35/116 (30%)
LRR_8 183..243 CDD:290566 14/59 (24%)
leucine-rich repeat 185..208 CDD:275380 3/22 (14%)
leucine-rich repeat 209..232 CDD:275380 6/22 (27%)
LRR_RI <225..416 CDD:238064 50/199 (25%)
LRR_8 232..291 CDD:290566 23/58 (40%)
leucine-rich repeat 233..256 CDD:275380 11/22 (50%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
leucine-rich repeat 281..304 CDD:275380 4/22 (18%)
LRR_8 304..363 CDD:290566 13/65 (20%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
leucine-rich repeat 329..352 CDD:275380 3/22 (14%)
LRR_8 352..416 CDD:290566 14/72 (19%)
leucine-rich repeat 353..376 CDD:275380 4/23 (17%)
LRRCT 414..>450 CDD:214507 5/35 (14%)
lgi2bNP_001034731.1 LRR_8 109..167 CDD:290566 22/57 (39%)
LRR_4 109..149 CDD:289563 16/39 (41%)
leucine-rich repeat 111..134 CDD:275378 11/22 (50%)
leucine-rich repeat 135..158 CDD:275378 8/22 (36%)
LRR_4 136..>167 CDD:289563 11/30 (37%)
leucine-rich repeat 159..171 CDD:275378 4/11 (36%)
LRRCT 167..215 CDD:214507 11/59 (19%)
EPTP 219..260 CDD:281697 7/40 (18%)
EPTP 265..306 CDD:281697 9/55 (16%)
EPTP 311..357 CDD:281697 10/40 (25%)
EPTP 360..402 CDD:281697
EPTP 407..448 CDD:281697
EPTP 453..493 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.