DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Con and lgi2a

DIOPT Version :9

Sequence 1:	NP_001246635.1	Gene:	Con / 38590	FlyBaseID:	FBgn0005775	Length:	691	Species:	Drosophila melanogaster
Sequence 2:	NP_001034730.1	Gene:	lgi2a / 654827	ZFINID:	ZDB-GENE-060217-2	Length:	536	Species:	Danio rerio

Alignment Length:	117	Identity:	40/117 - (34%)
Similarity:	63/117 - (53%)	Gaps:	3/117 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   173 YIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELN 237
            |:|..|...:.:||.:...:|:   ||...|:::|.|:.::||:|.:..:..|||:....|..|.
Zfish    45 YVPRYIPNDVSSLSIVNGTFSE---VKEAMFSHMPSLQLLLLNSNALTTVRDDAFSGLPHLEYLF 106

  Fly   238 LEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHN 289
            :|:|:|....:|:||.|.....|.|.||||..|...||.|:..|..|:|..|
Zfish   107 IENNKIETTSKYSFRGLRDLTHLSLANNNIKALPRELFIDLDSLIELDLRGN 158

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Con	NP_001246635.1	LRR_RI	<147..291	CDD:238064	40/117 (34%)
		LRR_8	183..243	CDD:290566	18/59 (31%)
		leucine-rich repeat	185..208	CDD:275380	6/22 (27%)
		leucine-rich repeat	209..232	CDD:275380	7/22 (32%)
		LRR_RI	<225..416	CDD:238064	26/65 (40%)
		LRR_8	232..291	CDD:290566	23/58 (40%)
		leucine-rich repeat	233..256	CDD:275380	9/22 (41%)
		leucine-rich repeat	257..280	CDD:275380	10/22 (45%)
		leucine-rich repeat	281..304	CDD:275380	4/9 (44%)
		LRR_8	304..363	CDD:290566
		leucine-rich repeat	305..328	CDD:275380
		leucine-rich repeat	329..352	CDD:275380
		LRR_8	352..416	CDD:290566
		leucine-rich repeat	353..376	CDD:275380
		LRRCT	414..>450	CDD:214507
lgi2a	NP_001034730.1	LRR_8	54..112	CDD:290566	18/60 (30%)
		LRR_8	100..158	CDD:290566	22/57 (39%)
		LRR_4	100..140	CDD:289563	15/39 (38%)
		leucine-rich repeat	102..125	CDD:275378	9/22 (41%)
		LRR_4	126..>158	CDD:289563	13/31 (42%)
		leucine-rich repeat	126..149	CDD:275378	10/22 (45%)
		leucine-rich repeat	150..162	CDD:275378	4/9 (44%)
		LRRCT	158..198	CDD:214507	1/1 (100%)
		EPTP	210..251	CDD:281697
		EPTP	257..297	CDD:281697
		EPTP	302..348	CDD:281697
		EPTP	351..393	CDD:281697
		EPTP	398..439	CDD:281697
		EPTP	443..484	CDD:281697
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574235
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X486
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.930