| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_071426.1 | Gene: | LRRC4 / 64101 | HGNCID: | 15586 | Length: | 653 | Species: | Homo sapiens |
| Alignment Length: | 309 | Identity: | 76/309 - (24%) |
|---|---|---|---|
| Similarity: | 128/309 - (41%) | Gaps: | 47/309 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 118 MCYCTPDENHVPVQKAECWVFSEGLHQNDTTWTRFYQQKRLRELKFVIQNNARLDYIPTMIIEPL 182
Fly 183 KNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMD 247
Fly 248 RYAFRNLPLCERLFLNN-NNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLT 311
Fly 312 RNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPA 376
Fly 377 LLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQWI 425 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 36/144 (25%) |
| LRR_8 | 183..243 | CDD:290566 | 15/59 (25%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 5/22 (23%) | ||
| LRR_RI | <225..416 | CDD:238064 | 54/191 (28%) | ||
| LRR_8 | 232..291 | CDD:290566 | 21/59 (36%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 304..363 | CDD:290566 | 16/58 (28%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 352..416 | CDD:290566 | 18/63 (29%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 6/22 (27%) | ||
| LRRCT | 414..>450 | CDD:214507 | 5/12 (42%) | ||
| LRRC4 | NP_071426.1 | LRRNT | 46..79 | CDD:214470 | 6/33 (18%) |
| LRR | <74..291 | CDD:227223 | 63/258 (24%) | ||
| LRR 1 | 76..97 | 6/35 (17%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 6/33 (18%) | ||
| LRR 2 | 100..121 | 3/20 (15%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 4/22 (18%) | ||
| LRR 3 | 124..145 | 5/20 (25%) | |||
| leucine-rich repeat | 125..148 | CDD:275380 | 5/22 (23%) | ||
| LRR 4 | 148..169 | 10/20 (50%) | |||
| leucine-rich repeat | 149..172 | CDD:275380 | 10/22 (45%) | ||
| LRR 5 | 172..194 | 6/21 (29%) | |||
| leucine-rich repeat | 173..197 | CDD:275380 | 6/23 (26%) | ||
| LRR 6 | 197..218 | 8/46 (17%) | |||
| leucine-rich repeat | 198..219 | CDD:275380 | 9/46 (20%) | ||
| LRR 7 | 219..240 | 6/20 (30%) | |||
| leucine-rich repeat | 220..243 | CDD:275380 | 8/22 (36%) | ||
| LRR 8 | 243..264 | 5/20 (25%) | |||
| leucine-rich repeat | 244..267 | CDD:275380 | 6/22 (27%) | ||
| LRR 9 | 267..288 | 6/20 (30%) | |||
| leucine-rich repeat | 268..289 | CDD:275380 | 6/20 (30%) | ||
| LRRCT | 300..351 | CDD:214507 | 5/12 (42%) | ||
| IG | 359..441 | CDD:214652 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||