DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and LGR6

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001017403.1 Gene:LGR6 / 59352 HGNCID:19719 Length:967 Species:Homo sapiens


Alignment Length:374 Identity:100/374 - (26%)
Similarity:158/374 - (42%) Gaps:66/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CYCTPDENHVPVQKAECWVFSE-----------------GLHQNDTTWTR---FYQQKRLRELKF 163
            |:|..|.   .:..|:|   ||                 .|..|:.|..:   |:..:.|.||:.
Human    39 CHCQEDG---IMLSADC---SELGLSAVPGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRL 97

  Fly   164 VIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFA 228
               :...|.:||......|.:|..::::.:|:..:.:.|...||.|:.:.|:.|.|..:.:.:|.
Human    98 ---SGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFE 159

  Fly   229 NHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINV 293
            ....||.|.|:.|.:.|:...|..|||..:.:.|..|.||.:.:..|.::..|..|:|.:|:|..
Human   160 GLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQH 224

  Fly   294 LTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNL 358
            |.:..|.||.||..|.|..|.|... ......|..|.||...:|.|:.|.|:|..|...|:|::.
Human   225 LGTHSFEGLHNLETLDLNYNKLQEF-PVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHF 288

  Fly   359 RNNLLKKIDNGLLRGTPAL--LSIN----VQ-------ANKLETLTFYTFQPIMDNLVNSTSELL 410
            .:|.::.:.....:..|.|  ||:|    :|       ...||.||          |..:...||
Human   289 YDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILT----------LTRAGIRLL 343

  Fly   411 VSDNKFICD--CRLQWIFELKNRTRHLQLRDSLEDLH-C-TLQEPKLSH 455
            .|.   :|.  .||: :.||.    |.|: :.|..|| | .|:|..|.|
Human   344 PSG---MCQQLPRLR-VLELS----HNQI-EELPSLHRCQKLEEIGLQH 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 38/146 (26%)
LRR_8 183..243 CDD:290566 15/59 (25%)
leucine-rich repeat 185..208 CDD:275380 4/22 (18%)
leucine-rich repeat 209..232 CDD:275380 5/22 (23%)
LRR_RI <225..416 CDD:238064 58/203 (29%)
LRR_8 232..291 CDD:290566 19/58 (33%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 5/22 (23%)
leucine-rich repeat 281..304 CDD:275380 9/22 (41%)
LRR_8 304..363 CDD:290566 19/58 (33%)
leucine-rich repeat 305..328 CDD:275380 6/22 (27%)
leucine-rich repeat 329..352 CDD:275380 9/22 (41%)
LRR_8 352..416 CDD:290566 17/76 (22%)
leucine-rich repeat 353..376 CDD:275380 3/22 (14%)
LRRCT 414..>450 CDD:214507 12/39 (31%)
LGR6NP_001017403.1 LRRNT 34..68 CDD:214470 7/34 (21%)
LRR_RI <57..199 CDD:238064 33/144 (23%)
leucine-rich repeat 70..91 CDD:275380 4/20 (20%)
LRR 1 91..112 6/23 (26%)
LRR_8 92..150 CDD:290566 15/60 (25%)
leucine-rich repeat 92..115 CDD:275380 7/25 (28%)
LRR 2 115..136 3/20 (15%)
leucine-rich repeat 116..139 CDD:275380 4/22 (18%)
LRR_RI 131..392 CDD:238064 80/273 (29%)
LRR 3 139..160 5/20 (25%)
leucine-rich repeat 140..163 CDD:275380 5/22 (23%)
LRR 4 163..186 8/22 (36%)
leucine-rich repeat 164..187 CDD:275380 9/22 (41%)
LRR_8 186..246 CDD:290566 20/59 (34%)
LRR 5 187..208 5/20 (25%)
leucine-rich repeat 188..211 CDD:275380 5/22 (23%)
LRR 6 211..232 7/20 (35%)
leucine-rich repeat 212..235 CDD:275380 9/22 (41%)
LRR 7 235..256 6/21 (29%)
leucine-rich repeat 236..258 CDD:275380 6/22 (27%)
LRR_8 258..314 CDD:290566 16/55 (29%)
LRR 8 258..279 8/20 (40%)
leucine-rich repeat 259..282 CDD:275380 9/22 (41%)
LRR 9 282..303 3/20 (15%)
leucine-rich repeat 283..304 CDD:275380 3/20 (15%)
LRR 10 306..328 5/21 (24%)
LRR 11 329..350 9/33 (27%)
leucine-rich repeat 330..344 CDD:275378 6/23 (26%)
LRR 12 353..374 9/26 (35%)
leucine-rich repeat 354..399 CDD:275380 13/36 (36%)
LRR_8 375..434 CDD:290566 4/9 (44%)
LRR 13 375..396 4/9 (44%)
leucine-rich repeat 376..390 CDD:275378 4/8 (50%)
LRR 14 399..420
leucine-rich repeat 400..423 CDD:275380
LRR 15 423..443
leucine-rich repeat 424..444 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.