DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and nyx

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001071085.1 Gene:nyx / 568821 ZFINID:ZDB-GENE-061026-3 Length:469 Species:Danio rerio


Alignment Length:414 Identity:99/414 - (23%)
Similarity:160/414 - (38%) Gaps:96/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CTRRRDMKLMCYCTPDENHVPV----QKAECWVFSEGLHQNDTTWTRFYQQKRLRELKFVIQNNA 169
            ||:.:...::|      :||.:    ::..|...|..|.:|              .|||:.:.  
Zfish    34 CTQEKSCSVLC------DHVNMMDLPKEFPCEASSINLDKN--------------SLKFLSER-- 76

  Fly   170 RLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLP-FLERIILNNNHIMALDQDAFANHIRL 233
                    ....|.:|.::.::|:.:..:...||..|| .:|..:.:|.:|..|....|....||
Zfish    77 --------AFGTLPSLKTLSLKYNNISFITPGAFKGLPNLVELKMAHNEYIRYLHTRTFTALKRL 133

  Fly   234 RELNLEHNQIFEM-DRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSE 297
            ..|:|....:|.| ||.....:.|.|.|...||....  .|....|..||.:.|..|:|..:...
Zfish   134 VRLDLSDCNLFNMPDRIFLEQITLKELLCFQNNFRRV--PGALRGMENLTHVYLERNKIEAVAYN 196

  Fly   298 IFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNL 362
            ...||.:|..|.|..|.:|.|.|..|.:|..|....|:||.:..:.::|..||:.||.|||..||
Zfish   197 SLLGLTSLKYLNLQENRINVIHDEAFKDLIRLENFYLNDNLLVDLPQQAFKGLSNLKMLNLGGNL 261

  Fly   363 LKK------------------------IDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLV 403
            |..                        |::|......:|:::::.:|.|.:|.|..||||.    
Zfish   262 LTNVSKTWFSDLVELEVLYLDRNRLSYIEDGSFENLTSLITLHLNSNNLTSLPFSVFQPIY---- 322

  Fly   404 NSTSELLVSDNKFICDCRLQWIFELKNRTRHLQLRDSLEDLHCT---------LQEPKLSHF--- 456
             ....|.:..|.:.|.|.|:|:.|      .::....:.|:.|.         |.|...:|.   
Zfish   323 -FIGRLYLFRNPWECTCDLEWLRE------WMESYKLVRDIPCASPSSVAGLDLSEVVFAHLNST 380

  Fly   457 -VDP--------VP--PTILDVLN 469
             :||        :|  ||:.:..|
Zfish   381 CLDPPELNMTTSLPDYPTVENKFN 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 34/145 (23%)
LRR_8 183..243 CDD:290566 15/60 (25%)
leucine-rich repeat 185..208 CDD:275380 6/23 (26%)
leucine-rich repeat 209..232 CDD:275380 5/22 (23%)
LRR_RI <225..416 CDD:238064 60/215 (28%)
LRR_8 232..291 CDD:290566 19/59 (32%)
leucine-rich repeat 233..256 CDD:275380 7/23 (30%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
leucine-rich repeat 281..304 CDD:275380 7/22 (32%)
LRR_8 304..363 CDD:290566 22/58 (38%)
leucine-rich repeat 305..328 CDD:275380 9/22 (41%)
leucine-rich repeat 329..352 CDD:275380 7/22 (32%)
LRR_8 352..416 CDD:290566 21/87 (24%)
leucine-rich repeat 353..376 CDD:275380 10/46 (22%)
LRRCT 414..>450 CDD:214507 9/44 (20%)
nyxNP_001071085.1 leucine-rich repeat 64..83 CDD:275380 6/42 (14%)
LRR_8 82..143 CDD:290566 15/60 (25%)
leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..132 CDD:275380 5/23 (22%)
LRR_RI <127..311 CDD:238064 51/185 (28%)
leucine-rich repeat 133..179 CDD:275380 14/47 (30%)
LRR_8 179..238 CDD:290566 20/58 (34%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
leucine-rich repeat 204..227 CDD:275380 9/22 (41%)
LRR_8 227..286 CDD:290566 15/58 (26%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
LRR_8 275..333 CDD:290566 12/62 (19%)
leucine-rich repeat 276..299 CDD:275380 2/22 (9%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)
LRRCT 332..>366 CDD:214507 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277227at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.