| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_688817.4 | Gene: | lrig1 / 560325 | ZFINID: | ZDB-GENE-031113-23 | Length: | 1022 | Species: | Danio rerio |
| Alignment Length: | 312 | Identity: | 88/312 - (28%) |
|---|---|---|---|
| Similarity: | 144/312 - (46%) | Gaps: | 60/312 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 142 LHQNDTTWTRFYQQKRLR-ELKFVIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFAN 205
Fly 206 LPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDR---YAFRNL------------- 254
Fly 255 -----PLCER---LFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLT 311
Fly 312 RNNLN-FIGDT--VFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRG 373
Fly 374 TPALLSINVQA-NKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQW 424 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 45/168 (27%) |
| LRR_8 | 183..243 | CDD:290566 | 16/59 (27%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 8/22 (36%) | ||
| LRR_RI | <225..416 | CDD:238064 | 62/218 (28%) | ||
| LRR_8 | 232..291 | CDD:290566 | 25/82 (30%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 7/43 (16%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 12/25 (48%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 304..363 | CDD:290566 | 22/61 (36%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 9/25 (36%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 352..416 | CDD:290566 | 12/64 (19%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 5/22 (23%) | ||
| LRRCT | 414..>450 | CDD:214507 | 6/11 (55%) | ||
| lrig1 | XP_688817.4 | LRRNT | 31..63 | CDD:214470 | |
| leucine-rich repeat | 63..84 | CDD:275380 | |||
| LRR_RI | 77..334 | CDD:238064 | 47/173 (27%) | ||
| LRR_8 | 83..142 | CDD:290566 | |||
| leucine-rich repeat | 85..107 | CDD:275380 | |||
| leucine-rich repeat | 108..131 | CDD:275380 | |||
| LRR_8 | 132..191 | CDD:290566 | 6/29 (21%) | ||
| leucine-rich repeat | 132..155 | CDD:275380 | |||
| leucine-rich repeat | 156..180 | CDD:275380 | 5/18 (28%) | ||
| leucine-rich repeat | 181..203 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 202..262 | CDD:290566 | 16/59 (27%) | ||
| leucine-rich repeat | 204..227 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 228..251 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 251..310 | CDD:290566 | 14/58 (24%) | ||
| leucine-rich repeat | 252..275 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 276..299 | CDD:275380 | 2/22 (9%) | ||
| LRR_8 | 299..358 | CDD:290566 | 25/58 (43%) | ||
| leucine-rich repeat | 300..323 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 324..347 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 348..372 | CDD:275380 | 8/23 (35%) | ||
| LRR_4 | 373..414 | CDD:289563 | 16/54 (30%) | ||
| LRR_8 | 374..433 | CDD:290566 | 20/88 (23%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 399..420 | CDD:275380 | 9/34 (26%) | ||
| LRRCT | 433..481 | CDD:214507 | 6/9 (67%) | ||
| Ig_3 | 485..572 | CDD:290638 | |||
| IG_like | 492..586 | CDD:214653 | |||
| I-set | 590..680 | CDD:254352 | |||
| Ig_1 | 607..681 | CDD:143240 | |||
| I-set | 684..771 | CDD:254352 | |||
| IGc2 | 698..761 | CDD:197706 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||