Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001122166.1 | Gene: | lrit3a / 558559 | ZFINID: | ZDB-GENE-080723-63 | Length: | 636 | Species: | Danio rerio |
Alignment Length: | 279 | Identity: | 70/279 - (25%) |
---|---|---|---|
Similarity: | 111/279 - (39%) | Gaps: | 59/279 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 256 LCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGD 320
Fly 321 TVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSI---NV 382
Fly 383 QANKLETL---------TFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQWIFEL-KNRTRHLQL 437
Fly 438 RDSLEDLHCT---------LQEPKLSHFVDPVPPTILDVLNIGGFTAIGSN-------------- 479
Fly 480 ----SASMGGVGNSVVGSS 494 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 6/34 (18%) |
LRR_8 | 183..243 | CDD:290566 | |||
leucine-rich repeat | 185..208 | CDD:275380 | |||
leucine-rich repeat | 209..232 | CDD:275380 | |||
LRR_RI | <225..416 | CDD:238064 | 45/171 (26%) | ||
LRR_8 | 232..291 | CDD:290566 | 6/34 (18%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 70/279 (25%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 304..363 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 329..352 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 352..416 | CDD:290566 | 22/75 (29%) | ||
leucine-rich repeat | 353..376 | CDD:275380 | 8/22 (36%) | ||
LRRCT | 414..>450 | CDD:214507 | 12/45 (27%) | ||
lrit3a | NP_001122166.1 | LRR_8 | 81..141 | CDD:290566 | 21/59 (36%) |
leucine-rich repeat | 83..106 | CDD:275378 | 6/22 (27%) | ||
LRR_4 | 107..145 | CDD:289563 | 16/37 (43%) | ||
leucine-rich repeat | 107..130 | CDD:275378 | 8/22 (36%) | ||
LRR_8 | 129..>171 | CDD:290566 | 16/44 (36%) | ||
LRR_4 | 129..170 | CDD:289563 | 16/43 (37%) | ||
leucine-rich repeat | 131..154 | CDD:275378 | 10/25 (40%) | ||
leucine-rich repeat | 155..168 | CDD:275378 | 4/12 (33%) | ||
TPKR_C2 | 199..249 | CDD:301599 | 14/51 (27%) | ||
Ig | 252..343 | CDD:299845 | 11/54 (20%) | ||
IG_like | 261..343 | CDD:214653 | 9/45 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170574221 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |