| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001005214.2 | Gene: | LRRC52 / 440699 | HGNCID: | 32156 | Length: | 313 | Species: | Homo sapiens |
| Alignment Length: | 246 | Identity: | 61/246 - (24%) |
|---|---|---|---|
| Similarity: | 99/246 - (40%) | Gaps: | 67/246 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 217 NHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPL-CERLFLNNNNISTL---HEGLFAD 277
Fly 278 MARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDN-RIER 341
Fly 342 ISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNST 406
Fly 407 SELLVSDNKFICDCR-LQW-----IFELKNRTRHLQLRDSLEDLHCTLQEP 451 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 22/77 (29%) |
| LRR_8 | 183..243 | CDD:290566 | 5/25 (20%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | |||
| leucine-rich repeat | 209..232 | CDD:275380 | 2/14 (14%) | ||
| LRR_RI | <225..416 | CDD:238064 | 49/195 (25%) | ||
| LRR_8 | 232..291 | CDD:290566 | 20/62 (32%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 12/25 (48%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 304..363 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 3/23 (13%) | ||
| LRR_8 | 352..416 | CDD:290566 | 14/63 (22%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 8/22 (36%) | ||
| LRRCT | 414..>450 | CDD:214507 | 9/41 (22%) | ||
| LRRC52 | NP_001005214.2 | PRK15387 | <2..>93 | CDD:185285 | 23/81 (28%) |
| LRRNT | 26..55 | CDD:214470 | 7/40 (18%) | ||
| leucine-rich repeat | 35..54 | CDD:275380 | 5/32 (16%) | ||
| LRR 1 | 54..75 | 9/20 (45%) | |||
| leucine-rich repeat | 55..78 | CDD:275380 | 11/22 (50%) | ||
| LRR 2 | 78..99 | 6/23 (26%) | |||
| LRR_8 | 79..136 | CDD:338972 | 17/56 (30%) | ||
| leucine-rich repeat | 79..102 | CDD:275380 | 6/22 (27%) | ||
| LRR 3 | 102..123 | 8/20 (40%) | |||
| leucine-rich repeat | 103..126 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 126..185 | CDD:338972 | 16/87 (18%) | ||
| LRR 4 | 126..148 | 3/21 (14%) | |||
| leucine-rich repeat | 127..151 | CDD:275380 | 3/23 (13%) | ||
| LRR 5 | 151..172 | 8/30 (27%) | |||
| leucine-rich repeat | 152..175 | CDD:275380 | 8/32 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141313 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||