DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and cDIP

DIOPT Version :10

Sequence 1:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:286 Identity:75/286 - (26%)
Similarity:112/286 - (39%) Gaps:71/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 EHNQIFEMDRYAFRNLPL---------------CERLFLNNNNISTLHEGLFADMARLTFLNLAH 288
            ||::....:...|.|.||               |...|:...|.|     :.||  :|..|.|:.
  Fly    93 EHSRTLIFENCTFTNFPLRLFYTLEVSELDMRGCGIRFIYWENFS-----IGAD--KLVILLLSD 150

  Fly   289 NQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTL 353
            |.|.||.::.|||.|||..:.|.||.|..:....|..|..|..|:|.:||:|.::.....||.:|
  Fly   151 NHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAADVFAGLKSL 215

  Fly   354 KTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQP--------------------- 397
            :.:.|..|.|..|::.|....|.|||:.:|.|:|..:..|.|:.                     
  Fly   216 RHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNNPELVVL 280

  Fly   398 --------------IMD--NLVNSTSELLVSDNKFICDCRLQWIFELKNRTRHLQLR-DSLEDLH 445
                          .:|  ||..|.:.:.:|||:.     .:..|.......||.|| :||..|.
  Fly   281 LLNINATNLTARNCSLDRVNLYGSVTNVDLSDNRV-----RELYFPASEALEHLVLRNNSLVQLA 340

  Fly   446 CTLQEPKLSHFVDPVPPTILDVLNIG 471
            ...:.|:|.|.      .:.|..|:|
  Fly   341 SLSRVPRLRHL------DVADNPNLG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_523930.3 LRR <157..459 CDD:443914 72/272 (26%)
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..256 CDD:275380 4/16 (25%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
leucine-rich repeat 281..304 CDD:275380 10/22 (45%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
leucine-rich repeat 329..352 CDD:275380 8/22 (36%)
leucine-rich repeat 353..376 CDD:275380 6/22 (27%)
cDIPNP_650951.1 LRR 107..>410 CDD:443914 72/272 (26%)
leucine-rich repeat 118..142 CDD:275380 6/30 (20%)
leucine-rich repeat 143..166 CDD:275380 10/22 (45%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
leucine-rich repeat 191..214 CDD:275380 8/22 (36%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..265 CDD:275380 8/25 (32%)
leucine-rich repeat 266..325 CDD:275380 8/63 (13%)
leucine-rich repeat 326..347 CDD:275380 7/20 (35%)
leucine-rich repeat 348..394 CDD:275380 5/19 (26%)
leucine-rich repeat 395..418 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.