Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262529.1 | Gene: | 2mit / 41616 | FlyBaseID: | FBgn0260793 | Length: | 1155 | Species: | Drosophila melanogaster |
Alignment Length: | 456 | Identity: | 94/456 - (20%) |
---|---|---|---|
Similarity: | 169/456 - (37%) | Gaps: | 155/456 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 YQQKR-LRELKF-VIQNNARLDY-----------------------------IPTMIIEPLKNLS 186
Fly 187 SIVIEYSQVEIVK-SYAFAN--LPFLERIILNNNHIMALDQDAFANHI-RLRELNLEHNQIFEMD 247
Fly 248 RYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTR 312
Fly 313 NNLNFIGDTVFAELWSLSELE---------------------LDDN------------------- 337
Fly 338 -----RIERISERALDGLNTLKTLNLRNNLLKKIDN-------------------------GLLR 372
Fly 373 -----------------GTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDC 420
Fly 421 RL---QWIFELKN-----------------RTRHLQLRDSLEDL---HCTLQEPKLSHFVDPVPP 462
Fly 463 T 463 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 44/172 (26%) |
LRR_8 | 183..243 | CDD:290566 | 18/63 (29%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 6/25 (24%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 4/23 (17%) | ||
LRR_RI | <225..416 | CDD:238064 | 62/278 (22%) | ||
LRR_8 | 232..291 | CDD:290566 | 22/58 (38%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 304..363 | CDD:290566 | 21/103 (20%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 329..352 | CDD:275380 | 11/67 (16%) | ||
LRR_8 | 352..416 | CDD:290566 | 20/105 (19%) | ||
leucine-rich repeat | 353..376 | CDD:275380 | 8/64 (13%) | ||
LRRCT | 414..>450 | CDD:214507 | 9/58 (16%) | ||
2mit | NP_001262529.1 | LRR_RI | 124..355 | CDD:238064 | 50/231 (22%) |
leucine-rich repeat | 124..143 | CDD:275380 | 0/18 (0%) | ||
leucine-rich repeat | 144..167 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 172..194 | CDD:275380 | 4/21 (19%) | ||
LRR_8 | 193..253 | CDD:290566 | 22/59 (37%) | ||
leucine-rich repeat | 195..218 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 219..242 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 241..301 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 243..311 | CDD:275380 | 15/67 (22%) | ||
leucine-rich repeat | 312..335 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 334..415 | CDD:290566 | 13/80 (16%) | ||
leucine-rich repeat | 336..359 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 360..380 | CDD:275380 | 6/19 (32%) | ||
LRR_8 | 379..460 | CDD:290566 | 14/85 (16%) | ||
LRR_4 | 379..>415 | CDD:289563 | 2/35 (6%) | ||
leucine-rich repeat | 381..404 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 405..449 | CDD:275380 | 8/48 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR45617 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |