DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and CG7800

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster


Alignment Length:355 Identity:74/355 - (20%)
Similarity:132/355 - (37%) Gaps:89/355 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 TRFYQQKRLRELKFVIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIIL 214
            :|.:..|:..:|     ....:|.....:::.:.||.::.:|..............||:|..:.|
  Fly    35 SRTFSDKKATKL-----TEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQL 94

  Fly   215 NNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMA 279
            ...:::.|..:.|:....::.|.|..|.|..:....|:.|.....|.|..|.|..|...:|.::.
  Fly    95 RRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLP 159

  Fly   280 RLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELE----------- 333
            .|..|:|:.|:|..|...||.|:..|.:|.|..|.|.:|..|....|.:|..|:           
  Fly   160 ELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLS 224

  Fly   334 --------LDDNRIER----------------ISERALDGLNTLKTLNLRNNLLKKIDNGLLRGT 374
                    ||::.::|                |:|..|...:::..|:|.:|||...|      .
  Fly   225 LPGAHTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKSSVIELDLHSNLLTATD------I 283

  Fly   375 PALLSINVQANKLETLTFYTFQPIMDNLV--------NSTSELLVSDNKFICDCRLQWIFELKNR 431
            |.||:...:..:|:         :.:|::        ::||||.:..|       |.::....||
  Fly   284 PKLLTGMWRLQRLD---------LSENIIGIYAAAGSDNTSELFILPN-------LMYMNLSANR 332

  Fly   432 TRHLQLRDSLEDLHCTLQEPKLSHFVDPVP 461
            ...|                   ||..|:|
  Fly   333 LTRL-------------------HFDSPIP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 29/140 (21%)
LRR_8 183..243 CDD:290566 12/59 (20%)
leucine-rich repeat 185..208 CDD:275380 3/22 (14%)
leucine-rich repeat 209..232 CDD:275380 4/22 (18%)
LRR_RI <225..416 CDD:238064 54/233 (23%)
LRR_8 232..291 CDD:290566 16/58 (28%)
leucine-rich repeat 233..256 CDD:275380 6/22 (27%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
leucine-rich repeat 281..304 CDD:275380 9/22 (41%)
LRR_8 304..363 CDD:290566 19/93 (20%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
leucine-rich repeat 329..352 CDD:275380 8/57 (14%)
LRR_8 352..416 CDD:290566 16/71 (23%)
leucine-rich repeat 353..376 CDD:275380 6/22 (27%)
LRRCT 414..>450 CDD:214507 5/35 (14%)
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 2/22 (9%)
leucine-rich repeat 65..85 CDD:275380 2/19 (11%)
LRR_8 87..147 CDD:290566 14/59 (24%)
leucine-rich repeat 89..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 6/22 (27%)
LRR_RI <131..334 CDD:238064 52/224 (23%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
LRR_8 140..195 CDD:290566 19/54 (35%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..246 CDD:275380 5/36 (14%)
leucine-rich repeat 247..267 CDD:275380 3/19 (16%)
leucine-rich repeat 268..292 CDD:275380 9/29 (31%)
leucine-rich repeat 293..322 CDD:275380 6/37 (16%)
leucine-rich repeat 395..406 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.