DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and atk

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001262113.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster


Alignment Length:276 Identity:71/276 - (25%)
Similarity:132/276 - (47%) Gaps:8/276 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 TRFYQQKRLRELKFVIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIIL 214
            |.|..|:.|..|.  :..||.||.  ::.:..|.||..|.:.|:|:..::|........:..|.|
  Fly   663 TAFDTQRSLEYLD--LSGNALLDI--SVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRL 723

  Fly   215 NNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMA 279
            :||.|:.|.|..|.|..:|:.|:|..|:|..::..|.:.|...:...|.:|.:..|.:.:|.::.
  Fly   724 SNNLIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELP 788

  Fly   280 RLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISE 344
            .|...:..:|::..::.|.|....:|..|.|:.|:...:.:.....:.:|..|:|..|.::.:|.
  Fly   789 SLLASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVST 853

  Fly   345 RALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSEL 409
            ..|..||.|..|.:.||.:.:|........|.|..::::.|:|.::...||:.:..|:    :.|
  Fly   854 MPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNI----AIL 914

  Fly   410 LVSDNKFICDCRLQWI 425
            .|..|...|:|.:||:
  Fly   915 DVDGNPIDCNCEMQWL 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 38/140 (27%)
LRR_8 183..243 CDD:290566 19/59 (32%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..232 CDD:275380 9/22 (41%)
LRR_RI <225..416 CDD:238064 44/190 (23%)
LRR_8 232..291 CDD:290566 13/58 (22%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 4/22 (18%)
leucine-rich repeat 281..304 CDD:275380 4/22 (18%)
LRR_8 304..363 CDD:290566 16/58 (28%)
leucine-rich repeat 305..328 CDD:275380 4/22 (18%)
leucine-rich repeat 329..352 CDD:275380 7/22 (32%)
LRR_8 352..416 CDD:290566 15/63 (24%)
leucine-rich repeat 353..376 CDD:275380 5/22 (23%)
LRRCT 414..>450 CDD:214507 5/12 (42%)
atkNP_001262113.1 leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
LRR_8 183..244 CDD:290566
leucine-rich repeat 185..209 CDD:275380
LRR_4 209..247 CDD:289563
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
LRR_RI 250..492 CDD:238064
LRR_8 259..318 CDD:290566
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
LRR_8 358..418 CDD:290566
leucine-rich repeat 360..383 CDD:275380
leucine-rich repeat 384..407 CDD:275380
LRR_8 406..466 CDD:290566
leucine-rich repeat 408..431 CDD:275380
leucine-rich repeat 432..455 CDD:275380
LRR_RI 447..705 CDD:238064 15/45 (33%)
LRR_8 454..514 CDD:290566
leucine-rich repeat 456..476 CDD:275380
leucine-rich repeat 480..501 CDD:275380
leucine-rich repeat 505..517 CDD:275378
leucine-rich repeat 525..550 CDD:275380
LRR_8 549..609 CDD:290566
leucine-rich repeat 551..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
LRR_8 622..681 CDD:290566 6/19 (32%)
leucine-rich repeat 623..646 CDD:275380
LRR_RI 647..896 CDD:238064 60/236 (25%)
leucine-rich repeat 647..670 CDD:275380 3/6 (50%)
leucine-rich repeat 671..693 CDD:275380 7/25 (28%)
leucine-rich repeat 694..717 CDD:275380 5/22 (23%)
LRR_8 716..776 CDD:290566 18/59 (31%)
leucine-rich repeat 718..741 CDD:275380 9/22 (41%)
leucine-rich repeat 742..763 CDD:275380 6/20 (30%)
LRR_8 765..824 CDD:290566 12/58 (21%)
leucine-rich repeat 766..789 CDD:275380 4/22 (18%)
leucine-rich repeat 790..813 CDD:275380 4/22 (18%)
leucine-rich repeat 814..835 CDD:275380 4/20 (20%)
leucine-rich repeat 838..861 CDD:275380 7/22 (32%)
LRR_8 862..921 CDD:290566 15/62 (24%)
leucine-rich repeat 862..885 CDD:275380 5/22 (23%)
leucine-rich repeat 886..906 CDD:275380 5/19 (26%)
TPKR_C2 919..>946 CDD:301599 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.