| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038939951.1 | Gene: | Lrg1 / 367455 | RGDID: | 1359464 | Length: | 342 | Species: | Rattus norvegicus |
| Alignment Length: | 290 | Identity: | 72/290 - (24%) |
|---|---|---|---|
| Similarity: | 113/290 - (38%) | Gaps: | 69/290 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 236 LNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFR 300
Fly 301 GLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKK 365
Fly 366 IDNGLLRGTPALLSINVQANKLETLTFYTFQP--------------------------------I 398
Fly 399 MDNLVNSTSELL----------------VSDNKFICD------CRLQWIFELKNRTRHLQLRDSL 441
Fly 442 EDLHCTLQEPKLSHFVDPVPPTILDVLNIG 471 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 16/54 (30%) |
| LRR_8 | 183..243 | CDD:290566 | 2/6 (33%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | |||
| leucine-rich repeat | 209..232 | CDD:275380 | |||
| LRR_RI | <225..416 | CDD:238064 | 57/227 (25%) | ||
| LRR_8 | 232..291 | CDD:290566 | 16/54 (30%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 304..363 | CDD:290566 | 20/58 (34%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 352..416 | CDD:290566 | 23/111 (21%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 11/22 (50%) | ||
| LRRCT | 414..>450 | CDD:214507 | 11/41 (27%) | ||
| Lrg1 | XP_038939951.1 | PRK15370 | <55..>293 | CDD:185268 | 56/226 (25%) |
| leucine-rich repeat | 65..86 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 87..110 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 111..134 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 135..158 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 159..182 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 183..206 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 231..254 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | 4/22 (18%) | ||
| PCC | 259..>339 | CDD:188093 | 21/94 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166334983 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.930 | |||||