DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and Lrfn1

DIOPT Version :10

Sequence 1:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001121166.1 Gene:Lrfn1 / 365222 RGDID:1304707 Length:766 Species:Rattus norvegicus


Alignment Length:325 Identity:83/325 - (25%)
Similarity:120/325 - (36%) Gaps:89/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 RLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTS 296
            |:.||.|..|.|..:.|..|.|:.....|.|:.|.|..:..|.|||:..|..|:|..|::..:..
  Rat    66 RVVELRLTDNFIAAVRRRDFANMTSLVHLTLSRNTIGQVAAGAFADLRALRALHLDSNRLAEVRG 130

  Fly   297 EIFRGLGNLNVLKLTRNNLNFIGDTVF-AELWSLSELELDDNRIERISERALDGLNTLKTLNLRN 360
            :..||||||..|.|..|.:..:....| |.|.::.:|:|..|.:|.:...|:..:..|.||.|.:
  Rat   131 DQLRGLGNLRHLILGNNQIRKVESAAFDAFLSTVEDLDLSYNNLEALPWEAVGQMVNLNTLTLDH 195

  Fly   361 NLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLV--------NSTSELLVS--DNK 415
            ||:..|..|.......|:.:::.:|:|..|.       .|.|.        ...:.|.||  .|.
  Rat   196 NLIDHIAEGTFVQLHKLVRLDMTSNRLHKLP-------PDGLFLRSQGGGPKPPTPLTVSFGGNP 253

  Fly   416 FICDCRLQWIFELKNRTRHLQLRDSLEDL----HCT------------LQEPKL----------- 453
            ..|:|.|.|:       |.|...|.||..    |.|            |.||.|           
  Rat   254 LHCNCELLWL-------RRLTREDDLETCATPEHLTDRYFWSIPEEEFLCEPPLITRQAGGRALV 311

  Fly   454 -------------------SHFVDP------------------VPPTILDVLNIGGFTAIGSNSA 481
                               .|:|.|                  :..||..:.:.|.||.|.||:|
  Rat   312 VEGQAVSLRCRAVGDPEPVVHWVAPDGRLLGNSSRTRVRGDGTLDVTITTLRDSGTFTCIASNAA 376

  Fly   482  481
              Rat   377  376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_523930.3 LRR <157..459 CDD:443914 73/283 (26%)
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380 83/325 (26%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
leucine-rich repeat 281..304 CDD:275380 7/22 (32%)
leucine-rich repeat 305..328 CDD:275380 7/23 (30%)
leucine-rich repeat 329..352 CDD:275380 5/22 (23%)
leucine-rich repeat 353..376 CDD:275380 8/22 (36%)
Lrfn1NP_001121166.1 LRR 1 66..87 8/20 (40%)
leucine-rich repeat 67..90 CDD:275380 8/22 (36%)
LRR <69..326 CDD:443914 70/270 (26%)
LRR 2 90..111 6/20 (30%)
leucine-rich repeat 91..114 CDD:275380 8/22 (36%)
LRR 3 114..135 4/20 (20%)
leucine-rich repeat 115..138 CDD:275380 7/22 (32%)
LRR 4 138..159 6/20 (30%)
leucine-rich repeat 139..163 CDD:275380 7/23 (30%)
LRR 5 163..184 5/20 (25%)
leucine-rich repeat 164..187 CDD:275380 5/22 (23%)
LRR 6 187..208 8/20 (40%)
leucine-rich repeat 188..211 CDD:275380 8/22 (36%)
LRR 7 211..232 6/27 (22%)
leucine-rich repeat 212..230 CDD:275380 5/24 (21%)
Ig 299..387 CDD:472250 13/78 (17%)
Ig strand B 317..321 CDD:409353 0/3 (0%)
Ig strand C 330..334 CDD:409353 1/3 (33%)
Ig strand E 353..357 CDD:409353 0/3 (0%)
Ig strand F 367..372 CDD:409353 2/4 (50%)
Ig strand G 380..383 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..422
fn3 426..500 CDD:394996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 568..601
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 646..742
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.