Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001129368.1 | Gene: | Lrrc24 / 362945 | RGDID: | 1308720 | Length: | 521 | Species: | Rattus norvegicus |
Alignment Length: | 217 | Identity: | 66/217 - (30%) |
---|---|---|---|
Similarity: | 94/217 - (43%) | Gaps: | 33/217 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 LNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFR 300
Fly 301 GLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKK 365
Fly 366 IDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDCRLQWIFE-LK 429
Fly 430 NRTRHLQLRDSLEDLHCTLQEP 451 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 18/54 (33%) |
LRR_8 | 183..243 | CDD:290566 | 3/6 (50%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | |||
leucine-rich repeat | 209..232 | CDD:275380 | |||
LRR_RI | <225..416 | CDD:238064 | 53/179 (30%) | ||
LRR_8 | 232..291 | CDD:290566 | 18/54 (33%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 6/19 (32%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 304..363 | CDD:290566 | 23/58 (40%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 329..352 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 352..416 | CDD:290566 | 11/63 (17%) | ||
leucine-rich repeat | 353..376 | CDD:275380 | 3/22 (14%) | ||
LRRCT | 414..>450 | CDD:214507 | 12/36 (33%) | ||
Lrrc24 | NP_001129368.1 | leucine-rich repeat | 61..83 | CDD:275380 | 6/19 (32%) |
PPP1R42 | 63..>212 | CDD:411060 | 52/177 (29%) | ||
LRR_8 | 84..142 | CDD:404697 | 21/57 (37%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 108..131 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 132..155 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 156..179 | CDD:275380 | 11/22 (50%) | ||
leucine-rich repeat | 180..203 | CDD:275380 | 8/51 (16%) | ||
PCC | 188..>259 | CDD:188093 | 21/68 (31%) | ||
Ig_3 | 267..357 | CDD:404760 | |||
Ig strand A | 267..271 | CDD:409353 | |||
Ig strand A' | 276..280 | CDD:409353 | |||
Ig strand B | 283..292 | CDD:409353 | |||
Ig strand C | 298..304 | CDD:409353 | |||
Ig strand D | 330..333 | CDD:409353 | |||
Ig strand E | 336..342 | CDD:409353 | |||
Ig strand F | 349..357 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334999 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |