DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and CG14762

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster


Alignment Length:405 Identity:104/405 - (25%)
Similarity:176/405 - (43%) Gaps:76/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DENHVPVQKAECWVFSE--------GLHQNDTTWTRFYQQKRLRELKFVIQNNARLDYIPTMIIE 180
            |..|:.:..:......|        ||.|.|.:         |.::|.|          |:..::
  Fly   105 DIRHLTIHNSSLAAIEENALSSLGAGLTQLDVS---------LNQMKTV----------PSQALQ 150

  Fly   181 PLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAF---ANHIRLRELNLEHNQ 242
            .|.:|..:.:.::::.::.:.||..|..||.:.|..|.|..:|.:||   .:||  :.|||..|.
  Fly   151 HLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHI--KRLNLGGND 213

  Fly   243 IFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNV 307
            :..:.:.|...|...::|.:..|.|.|:.||.|..:..|..|.||||.|..:.:.:|..|..||.
  Fly   214 LTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNS 278

  Fly   308 LKLTRNNLNFIGDTVFAEL-WSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLL 371
            |:|..|.::.|....|..| .:|..|.|.||:|..|...||..|:.|:.|:||||.:..:.....
  Fly   279 LELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAF 343

  Fly   372 RG-----------------TPALL--------SINVQANKLETLTFYTFQPIMDNLVNSTSELLV 411
            .|                 .|:||        ::|:|.|||:.:.    |.||:.::::...:.:
  Fly   344 TGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIP----QDIMEPVIDTLRIIDI 404

  Fly   412 SDNKFICDCRLQW----IFELKNRTRHL-QLRDSLEDLHCTLQEPKLSHFVDPVPPTILDVLNIG 471
            :||...|.|.|.|    :.:|||:...: |.:..|    |.:......:||..:|   .:.::..
  Fly   405 TDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKPL----CHMSLDNREYFVQAMP---TEKMHCA 462

  Fly   472 GFTAIGSNSASMGGV 486
            |...  |.|.:.||:
  Fly   463 GLNV--SPSPTSGGL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 38/146 (26%)
LRR_8 183..243 CDD:290566 18/62 (29%)
leucine-rich repeat 185..208 CDD:275380 4/22 (18%)
leucine-rich repeat 209..232 CDD:275380 9/25 (36%)
LRR_RI <225..416 CDD:238064 64/219 (29%)
LRR_8 232..291 CDD:290566 19/58 (33%)
leucine-rich repeat 233..256 CDD:275380 6/22 (27%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
leucine-rich repeat 281..304 CDD:275380 9/22 (41%)
LRR_8 304..363 CDD:290566 24/59 (41%)
leucine-rich repeat 305..328 CDD:275380 8/23 (35%)
leucine-rich repeat 329..352 CDD:275380 10/22 (45%)
LRR_8 352..416 CDD:290566 20/88 (23%)
leucine-rich repeat 353..376 CDD:275380 7/39 (18%)
LRRCT 414..>450 CDD:214507 11/40 (28%)
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 104/405 (26%)
LRR_RI 93..384 CDD:238064 79/299 (26%)
leucine-rich repeat 107..129 CDD:275380 2/21 (10%)
leucine-rich repeat 131..154 CDD:275380 8/41 (20%)
LRR_8 154..214 CDD:290566 18/61 (30%)
leucine-rich repeat 155..178 CDD:275380 4/22 (18%)
leucine-rich repeat 179..203 CDD:275380 8/23 (35%)
leucine-rich repeat 204..227 CDD:275380 7/24 (29%)
LRR_8 226..286 CDD:290566 21/59 (36%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
LRR_8 276..335 CDD:290566 24/58 (41%)
leucine-rich repeat 276..300 CDD:275380 8/23 (35%)
leucine-rich repeat 301..324 CDD:275380 10/22 (45%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
LRR_8 349..409 CDD:290566 13/63 (21%)
leucine-rich repeat 350..373 CDD:275380 3/22 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277227at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.