| Sequence 1: | NP_001246635.1 | Gene: | Con / 38590 | FlyBaseID: | FBgn0005775 | Length: | 691 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_940908.3 | Gene: | LRIT3 / 345193 | HGNCID: | 24783 | Length: | 679 | Species: | Homo sapiens |
| Alignment Length: | 252 | Identity: | 69/252 - (27%) |
|---|---|---|---|
| Similarity: | 110/252 - (43%) | Gaps: | 31/252 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 249 YAFRNLPLCERLFL-NNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTR 312
Fly 313 NNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPAL 377
Fly 378 LSINVQANKLETLTFYTFQPIMDNLVNSTSELL----------VSDNKFICDCRLQWIFEL-KNR 431
Fly 432 TRHLQLRDSLEDLHCT---------LQEPKLSHFVDPVPPTILDVLNIGGFTAIGSN 479 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Con | NP_001246635.1 | LRR_RI | <147..291 | CDD:238064 | 11/42 (26%) |
| LRR_8 | 183..243 | CDD:290566 | |||
| leucine-rich repeat | 185..208 | CDD:275380 | |||
| leucine-rich repeat | 209..232 | CDD:275380 | |||
| LRR_RI | <225..416 | CDD:238064 | 50/177 (28%) | ||
| LRR_8 | 232..291 | CDD:290566 | 11/42 (26%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 3/6 (50%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 304..363 | CDD:290566 | 20/58 (34%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 352..416 | CDD:290566 | 21/73 (29%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 9/22 (41%) | ||
| LRRCT | 414..>450 | CDD:214507 | 11/45 (24%) | ||
| LRIT3 | NP_940908.3 | LRR 1 | 56..79 | 5/25 (20%) | |
| leucine-rich repeat | 59..82 | CDD:275378 | 5/25 (20%) | ||
| LRR_8 | 61..117 | CDD:290566 | 18/58 (31%) | ||
| LRR 2 | 80..103 | 7/22 (32%) | |||
| leucine-rich repeat | 83..106 | CDD:275378 | 7/22 (32%) | ||
| LRR 3 | 104..128 | 8/23 (35%) | |||
| LRR_8 | 105..165 | CDD:290566 | 18/59 (31%) | ||
| LRR_4 | 105..146 | CDD:289563 | 13/40 (33%) | ||
| leucine-rich repeat | 107..130 | CDD:275378 | 7/22 (32%) | ||
| LRR 4 | 129..151 | 8/21 (38%) | |||
| LRR_4 | 131..170 | CDD:289563 | 14/39 (36%) | ||
| leucine-rich repeat | 131..154 | CDD:275378 | 9/22 (41%) | ||
| LRR 5 | 152..175 | 6/23 (26%) | |||
| leucine-rich repeat | 155..168 | CDD:275378 | 3/12 (25%) | ||
| Ig | 267..345 | CDD:299845 | 3/4 (75%) | ||
| IG_like | 267..345 | CDD:214653 | 3/4 (75%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 351..375 | ||||
| FN3 | 486..550 | CDD:214495 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141315 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||