DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Con and CG5096

DIOPT Version :9

Sequence 1:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:351 Identity:81/351 - (23%)
Similarity:142/351 - (40%) Gaps:110/351 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CWVFSE--GLHQNDTTWTRFYQQK-RLRELKFVIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVE 196
            |.|.|:  |..:::||.|...::| ::.:.|...:.|.   ||.|.:::..:.|           
  Fly    15 CIVLSQVSGQTKDETTTTETPKEKIKVIDSKLCKKCNC---YIDTNLLDCSEKL----------- 65

  Fly   197 IVKSYAFANLPFLERIILNNNHIMALDQDAFAN-HIRLRELNLEHNQIFEMDRYAFRNLPL---- 256
                               .:.:.|.|.:...| ::..:.:|||||.:        .::|:    
  Fly    66 -------------------QDWLSAEDWEDLTNGNVVFKTINLEHNNL--------TSVPILPKY 103

  Fly   257 -CERLFLNNNNISTLHEGLFADMARLTFLNLAHNQI--NVLTSEIFRG---------LGNLNVLK 309
             .|.|:|.||.|.::..|.|.::..|..|:|:||::  .||..::|:|         |.||..|.
  Fly   104 DVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLN 168

  Fly   310 LTRNNLNFIGDTVFAELWSLSELELDDNR---IERISERALDGLNTLKTLNL------------- 358
            |..|:|:.:...:|..:..:.||.|..|.   |:::||.|:.||.:||.|::             
  Fly   169 LGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTIL 233

  Fly   359 -----------RNNLLKKIDNGLLRGTPALLSINVQANKLETL-----------------TF--- 392
                       ..||..::...|...| .|.|:.:..|.:|.|                 ||   
  Fly   234 HGPRDLEIFIAAGNLFNQLPKALKYAT-NLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSK 297

  Fly   393 -YTFQPIMDNLVNSTSELLVSDNKFI 417
             |...|...:.:.|.:||::||||.:
  Fly   298 LYKIGPGAFSELQSLTELILSDNKLL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 32/150 (21%)
LRR_8 183..243 CDD:290566 9/60 (15%)
leucine-rich repeat 185..208 CDD:275380 1/22 (5%)
leucine-rich repeat 209..232 CDD:275380 3/23 (13%)
LRR_RI <225..416 CDD:238064 64/255 (25%)
LRR_8 232..291 CDD:290566 19/63 (30%)
leucine-rich repeat 233..256 CDD:275380 5/22 (23%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
leucine-rich repeat 281..304 CDD:275380 10/33 (30%)
LRR_8 304..363 CDD:290566 21/85 (25%)
leucine-rich repeat 305..328 CDD:275380 6/22 (27%)
leucine-rich repeat 329..352 CDD:275380 10/25 (40%)
LRR_8 352..416 CDD:290566 22/108 (20%)
leucine-rich repeat 353..376 CDD:275380 7/46 (15%)
LRRCT 414..>450 CDD:214507 2/4 (50%)
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 67/264 (25%)
leucine-rich repeat 85..104 CDD:275380 6/26 (23%)
LRR_8 105..174 CDD:290566 23/68 (34%)
leucine-rich repeat 105..128 CDD:275380 8/22 (36%)
leucine-rich repeat 129..163 CDD:275380 10/33 (30%)
LRR_8 163..222 CDD:290566 20/58 (34%)
leucine-rich repeat 164..187 CDD:275380 6/22 (27%)
leucine-rich repeat 188..214 CDD:275380 10/25 (40%)
leucine-rich repeat 215..238 CDD:275380 3/22 (14%)
leucine-rich repeat 239..261 CDD:275380 4/22 (18%)
LRR_8 260..322 CDD:290566 16/62 (26%)
leucine-rich repeat 262..286 CDD:275380 5/23 (22%)
leucine-rich repeat 287..311 CDD:275380 4/23 (17%)
leucine-rich repeat 346..369 CDD:275380
leucine-rich repeat 370..388 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.